Property Summary

NCBI Gene PubMed Count 60
PubMed Score 551.78
PubTator Score 119.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.158 1.5e-02
acute quadriplegic myopathy 1.731 3.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.332 2.3e-03
chronic rhinosinusitis -1.117 8.5e-03
colon cancer -2.600 1.2e-03
cystic fibrosis 2.228 4.8e-04
esophageal adenocarcinoma -1.400 4.4e-02
group 3 medulloblastoma 1.300 5.4e-03
juvenile dermatomyositis 1.254 1.1e-11
lung cancer -1.200 2.7e-03
malignant mesothelioma -1.200 1.4e-05
medulloblastoma, large-cell 1.200 2.3e-04
mucosa-associated lymphoid tissue lympho... 1.718 2.0e-02
nasopharyngeal carcinoma -1.300 9.9e-03
oligodendroglioma 1.200 3.3e-02
ovarian cancer -2.800 1.2e-08
pancreatic cancer -1.200 5.8e-03
pancreatic carcinoma -1.200 5.8e-03
primitive neuroectodermal tumor 1.100 1.7e-03

Gene RIF (47)

AA Sequence

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRG      1 - 70
GTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKK     71 - 140
SSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEI    141 - 210
SMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSV    211 - 280
NSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGF    281 - 350
SHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQ    351 - 420
PLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELALALSRGLQLD    421 - 490
TQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQEFDKSSTIPRNSDISQSYRR    491 - 560
MFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVL    561 - 630
PAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQER    631 - 700
EPPSATVSPGQIPESDPADLSPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS                   701 - 755
//

Text Mined References (62)

PMID Year Title