Property Summary

NCBI Gene PubMed Count 52
Grant Count 22
R01 Count 14
Funding $3,008,007.37
PubMed Score 495.82
PubTator Score 119.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

PMID Text
26621336 Low expression of Mtss1 is associated with Chronic myeloid leukemia.
26316204 MTSS1 plays an essential inhibitory role in the development and progression of ovarian cancers
26198729 Down-regulation of MTSS1 expression is associated with lymph node metastasis in Pancreatic Cancer.
26119942 human breast tumors data sets the MTSS1/p63 co-expression is a negative prognostic factor on patient survival, suggesting that the MTSS1/p63 axis might be functionally important to regulate breast tumor progression
25996952 our findings suggest that MTSS1 might have a context-dependent function and could act as a tumor suppressor, which is pharmacologically targetable in AML patients.
25783158 EGF induces microRNAs that target suppressors of cell migration: miR-15b targets MTSS1 in breast cancer.
25625275 Data shows that MTSS1 is highly expressed in non-small-cell lung carcinomas compared with non-neoplastic lung tissues and may serve as an independent prognostic factor.
25385572 These results implicate that the role of MTSS1 suppresses cell migration and invasion by inhibiting expression of CTTN and as a prognosis biomarker in Glioblastomas
25287652 The absence of MIM led to PTPdelta-mediated activation of SRC.
24632752 MTSS1 is a metastasis driver in a subset of human melanomas.
More...

AA Sequence

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRG      1 - 70
GTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKK     71 - 140
SSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEI    141 - 210
SMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSV    211 - 280
NSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGF    281 - 350
SHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQ    351 - 420
PLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELALALSRGLQLD    421 - 490
TQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQEFDKSSTIPRNSDISQSYRR    491 - 560
MFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVL    561 - 630
PAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQER    631 - 700
EPPSATVSPGQIPESDPADLSPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS                   701 - 755
//

Text Mined References (54)

PMID Year Title
26621336 2016 Mtss1 is a critical epigenetically regulated tumor suppressor in CML.
26316204 2015 Metastasis suppressor 1 expression in human ovarian cancer: The impact on cellular migration and metastasis.
26198729 2016 Expression and Significances of MTSS1 in Pancreatic Cancer.
26119942 2016 p63 controls cell migration and invasion by transcriptional regulation of MTSS1.
25996952 2015 Identification of the Adapter Molecule MTSS1 as a Potential Oncogene-Specific Tumor Suppressor in Acute Myeloid Leukemia.
25783158 2015 EGF induces microRNAs that target suppressors of cell migration: miR-15b targets MTSS1 in breast cancer.
25625275 2015 Downregulation of MTSS1 expression is an independent prognosticator in squamous cell carcinoma of the lung.
25385572 2015 MTSS1 suppresses cell migration and invasion by targeting CTTN in glioblastoma.
25287652 2015 Missing-in-Metastasis regulates cell motility and invasion via PTP?-mediated changes in SRC activity.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
More...