Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.74
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.800 2.2e-08
Astrocytoma, Pilocytic -1.100 3.3e-08
atypical teratoid / rhabdoid tumor -1.900 8.3e-09
breast carcinoma -1.300 5.9e-05
ductal carcinoma in situ -1.200 7.4e-03
ependymoma -1.600 4.4e-15
glioblastoma -1.500 1.2e-10
invasive ductal carcinoma -1.800 5.8e-03
malignant mesothelioma -1.200 1.2e-05
medulloblastoma, large-cell -1.300 1.4e-05
osteosarcoma -1.673 2.0e-04
ovarian cancer -1.100 5.7e-10
psoriasis -3.000 5.6e-06
subependymal giant cell astrocytoma -1.365 3.9e-02

Gene RIF (4)

AA Sequence

MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQWTADCSEPLD      1 - 70
SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHI     71 - 140
DREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFRRRRNDRRRQQRPPGGNKPQQHG    141 - 210
DHQPGSAKHNRDHQKSYQGGSAPHPSGRPTHHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENP    211 - 280
KLEDTAGDTGHSSLEAPRSPDTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRL    281 - 350
RRRLKEKDEVAVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIYQK    351 - 420
AVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRS    421 - 490
STGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASARDKMLCPSES    491 - 560
MLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA                                    561 - 598
//

Text Mined References (23)

PMID Year Title