Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.00
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 6.09804355633023E-13
glioblastoma 5572 1.17470248437545E-10
ovarian cancer 8492 5.67792912257912E-10
atypical teratoid / rhabdoid tumor 4369 8.34942832356387E-9
adult high grade glioma 2148 2.22972057037658E-8
pilocytic astrocytoma 3086 3.06490115432985E-8
malignant mesothelioma 3163 4.63440145763556E-7
psoriasis 6685 5.62748336944316E-6
medulloblastoma, large-cell 6234 1.4093711280056E-5
breast carcinoma 1614 5.86525153503873E-5
osteosarcoma 7933 2.03586775620176E-4
invasive ductal carcinoma 2950 0.00581032338231712
ductal carcinoma in situ 1745 0.00741193777745589
subependymal giant cell astrocytoma 2287 0.0385519056141102

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -3.000 0.000
osteosarcoma -1.673 0.000
posterior fossa group B ependymoma -1.700 0.000
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.300 0.000
breast carcinoma -1.300 0.000
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.365 0.039
ductal carcinoma in situ -1.200 0.007
invasive ductal carcinoma -1.800 0.006
ovarian cancer -1.100 0.000

Synonym

Accession O43310 B3KTR8 Q8IVD5
Symbols Gm672
KIAA0427

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (4)

PMID Text
26264041 association of SNPs in LCP1 and CTIF with hearing
21840310 Study reveals that Ago2, but not Ago2F2V2, inhibits the binding of CBP80/20 to cap structure.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19648179 a new MIF4G domain-containing protein, CTIF that interacts directly with CBP80 and is part of the CBP80/20-dependent translation initiation complex [CBP80/20-dependent translation initiation factor, CTIF]

AA Sequence

MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQWTADCSEPLD      1 - 70
SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHI     71 - 140
DREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFRRRRNDRRRQQRPPGGNKPQQHG    141 - 210
DHQPGSAKHNRDHQKSYQGGSAPHPSGRPTHHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENP    211 - 280
KLEDTAGDTGHSSLEAPRSPDTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRL    281 - 350
RRRLKEKDEVAVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIYQK    351 - 420
AVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRS    421 - 490
STGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASARDKMLCPSES    491 - 560
MLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA                                    561 - 598
//

Text Mined References (23)

PMID Year Title
26264041 2015 Association of SNPs in LCP1 and CTIF with hearing in 11 year old children: findings from the Avon Longitudinal Study of Parents and Children (ALSPAC) birth cohort and the G-EAR consortium.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21840310 2011 Ago2/miRISC-mediated inhibition of CBP80/20-dependent translation and thereby abrogation of nonsense-mediated mRNA decay require the cap-associating activity of Ago2.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...