Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
Funding $593,195
PubMed Score 5.00
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -3.000 0.000
osteosarcoma -1.673 0.000
posterior fossa group B ependymoma -1.700 0.000
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.300 0.000
breast carcinoma -1.300 0.000
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.365 0.039
ductal carcinoma in situ -1.200 0.007
invasive ductal carcinoma -1.800 0.006
ovarian cancer -1.100 0.000

Gene RIF (4)

PMID Text
26264041 association of SNPs in LCP1 and CTIF with hearing
21840310 Study reveals that Ago2, but not Ago2F2V2, inhibits the binding of CBP80/20 to cap structure.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19648179 a new MIF4G domain-containing protein, CTIF that interacts directly with CBP80 and is part of the CBP80/20-dependent translation initiation complex [CBP80/20-dependent translation initiation factor, CTIF]

AA Sequence

MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQWTADCSEPLD      1 - 70
SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHI     71 - 140
DREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFRRRRNDRRRQQRPPGGNKPQQHG    141 - 210
DHQPGSAKHNRDHQKSYQGGSAPHPSGRPTHHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENP    211 - 280
KLEDTAGDTGHSSLEAPRSPDTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRL    281 - 350
RRRLKEKDEVAVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIYQK    351 - 420
AVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRS    421 - 490
STGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASARDKMLCPSES    491 - 560
MLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA                                    561 - 598
//

Text Mined References (23)

PMID Year Title
26264041 2015 Association of SNPs in LCP1 and CTIF with hearing in 11 year old children: findings from the Avon Longitudinal Study of Parents and Children (ALSPAC) birth cohort and the G-EAR consortium.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21840310 2011 Ago2/miRISC-mediated inhibition of CBP80/20-dependent translation and thereby abrogation of nonsense-mediated mRNA decay require the cap-associating activity of Ago2.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...