Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.45
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.7e-04
group 3 medulloblastoma 4104 5.0e-04
medulloblastoma, large-cell 6241 1.4e-03
lung cancer 4740 2.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Myoma 12 3.523 1.8
Uterine fibroid 28 3.118 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 5.0e-04
lung cancer 1.900 2.8e-03
malignant mesothelioma -1.100 1.7e-04
medulloblastoma, large-cell 1.100 1.4e-03

AA Sequence

MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSRLREL      1 - 70
CHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTVLEDLERELDEPGEQVSVHTG     71 - 140
EQEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVSEEMEPHGKTS    141 - 210
SKFENDMSKSARCGETREPEEITEEPSACSREDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCG    211 - 280
KAFSQHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQR    281 - 350
LHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECG    351 - 420
KAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRI    421 - 490
HTGERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKPYQCDECGK    491 - 560
AFRQRKKTSYKEILLKNHSEPQAGVNLLLSSLIPEWQSCFRRDL                              561 - 604
//

Text Mined References (9)

PMID Year Title