Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.83
PubTator Score 27.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 1.1e-04
astrocytic glioma -1.300 5.1e-03
atypical teratoid / rhabdoid tumor -1.800 4.4e-05
ependymoma -1.500 1.4e-02
glioblastoma -1.200 1.6e-05
group 3 medulloblastoma 1.200 2.5e-02
lung cancer -1.200 3.3e-03
lung carcinoma 2.400 2.6e-41
malignant mesothelioma 3.800 9.1e-09
medulloblastoma, large-cell -1.500 8.5e-04
osteosarcoma -1.056 1.4e-03
Pick disease -1.200 1.2e-02
primitive neuroectodermal tumor -1.300 6.6e-04
psoriasis -1.900 1.9e-05
subependymal giant cell astrocytoma -1.969 7.0e-03

Gene RIF (13)

AA Sequence

MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQED      1 - 70
EVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMF     71 - 140
SDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSK    141 - 210
LMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNV    211 - 280
TQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLC    281 - 350
KKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF    351 - 420
REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQ    421 - 490
VFEFTEPKRSQSPFWQNFSRLTPFKK                                                491 - 516
//

Text Mined References (27)

PMID Year Title