Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.26
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.000 0.009
ependymoma -2.800 0.000
oligodendroglioma -1.600 0.031
glioblastoma -2.600 0.000
sonic hedgehog group medulloblastoma -2.900 0.000
atypical teratoid/rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.300 0.001
primitive neuroectodermal tumor -2.800 0.000
lung cancer 2.500 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -2.600 0.000
subependymal giant cell astrocytoma -3.203 0.001
Pick disease -2.200 0.001
progressive supranuclear palsy -1.200 0.049
pituitary cancer 1.200 0.002
head and neck cancer -1.100 0.014

Synonym

Accession O43304
Symbols PRELID4B

Gene

PANTHER Protein Class (1)

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MVQRYQSPVRVYKYPFELVMAAYEKRFPTCPQIPVFLGSEVLRESRSPDGAVHVVERSCRLRVDAPRLLR      1 - 70
KIAGVEHVVFVQTNILNWKERTLLIEAHNETFANRVVVNEHCSYTVHPENEDWTCFEQSASLDIRSFFGF     71 - 140
ENALEKIAMKQYTANVKRGKEVIEHYLNELISQGTSHIPRWTPAPVREEDARNQAGPRDPSSLEAHGPRS    141 - 210
TLGPALEAVSMDGDKLDADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKDEHILRFLRAHDFHLDK    211 - 280
AREMLRQSLSWRKQHQVDLLLQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEAL    281 - 350
LRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLL    351 - 420
IVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPK    421 - 490
SLYMTEEEQEHTDQLWQWSETYHSASVLRGAPHEVAVEILEGESVITWDFDILRGDVVFSLYHTKQAPRL    491 - 560
GAREPGTRASGQLIDKGWVLGRDYSRVEAPLVCREGESIQGSHVTRWPGVYLLQWQMHSPPSSVACSLPG    561 - 630
VDDVLTALHSPGPKCKLLYYCEVLASEDFRGSMSSLESCTSGFSQLSAATSSSSSGQSHSSSLVSR        631 - 696
//

Text Mined References (4)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
17428729 2007 The lipid-binding SEC14 domain.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.