Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.26
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
lung cancer 2.100 3.5e-04
adult high grade glioma -2.100 3.6e-04
astrocytic glioma -2.000 8.7e-03
Astrocytoma, Pilocytic -2.500 3.7e-09
atypical teratoid / rhabdoid tumor -2.600 3.4e-09
ependymoma -2.200 1.0e-02
glioblastoma -2.200 3.4e-07
group 3 medulloblastoma -2.200 7.1e-03
head and neck cancer -1.100 1.4e-02
medulloblastoma, large-cell -2.300 6.2e-04
oligodendroglioma -1.600 3.1e-02
Pick disease -2.200 1.0e-03
pituitary cancer 1.200 2.2e-03
primitive neuroectodermal tumor -2.800 2.8e-05
progressive supranuclear palsy -1.200 4.9e-02
subependymal giant cell astrocytoma -3.203 1.2e-03

Synonym

Accession O43304
Symbols PRELID4B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MVQRYQSPVRVYKYPFELVMAAYEKRFPTCPQIPVFLGSEVLRESRSPDGAVHVVERSCRLRVDAPRLLR      1 - 70
KIAGVEHVVFVQTNILNWKERTLLIEAHNETFANRVVVNEHCSYTVHPENEDWTCFEQSASLDIRSFFGF     71 - 140
ENALEKIAMKQYTANVKRGKEVIEHYLNELISQGTSHIPRWTPAPVREEDARNQAGPRDPSSLEAHGPRS    141 - 210
TLGPALEAVSMDGDKLDADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKDEHILRFLRAHDFHLDK    211 - 280
AREMLRQSLSWRKQHQVDLLLQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEAL    281 - 350
LRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLL    351 - 420
IVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPK    421 - 490
SLYMTEEEQEHTDQLWQWSETYHSASVLRGAPHEVAVEILEGESVITWDFDILRGDVVFSLYHTKQAPRL    491 - 560
GAREPGTRASGQLIDKGWVLGRDYSRVEAPLVCREGESIQGSHVTRWPGVYLLQWQMHSPPSSVACSLPG    561 - 630
VDDVLTALHSPGPKCKLLYYCEVLASEDFRGSMSSLESCTSGFSQLSAATSSSSSGQSHSSSLVSR        631 - 696
//

Text Mined References (5)

PMID Year Title