Property Summary

NCBI Gene PubMed Count 40
Grant Count 6
R01 Count 6
Funding $394,504.25
PubMed Score 25.50
PubTator Score 27.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.030
oligodendroglioma -1.500 0.050
osteosarcoma -1.444 0.004
atypical teratoid / rhabdoid tumor -1.200 0.003
glioblastoma -1.300 0.000
Breast cancer 3.000 0.024
adult high grade glioma -1.300 0.008
pilocytic astrocytoma -1.200 0.000
posterior fossa group A ependymoma -1.100 0.000
subependymal giant cell astrocytoma -1.687 0.048
ovarian cancer -1.100 0.000
pituitary cancer -1.700 0.000

Gene RIF (17)

PMID Text
26487539 We demonstrated that restoration of CP110 expression in MDA-MB-231 and MCF-7 cells by miR-129 overexpression rendered the cells sensitive to docetaxel.
26304236 Data show thata combining cyclin-dependent kinase 2 (CDK2) antagonism and ubiquitin thioesterase 33 (USP33) depletion augments anaphase catastrophe via changes in centrosomal protein of 110 kDa (CP110) protein expression.
25808870 CP110 plays a mechanistic role in response of lung cancer cells to CDK2 inhibition, especially in the presence of activated KRAS mutations.
25753040 Centrin2 regulates primary ciliogenesis through controlling CP110 levels.
25201258 Both protein and mRNA levels of ciliogenesis-associated markers CP110, Foxj1, TAp73 were significantly increased in patients with nasal polyps versus those seen in control subjects and were positively correlated with cilia length
23486064 using human cells, identification of a new mechanism for the regulation of centrosome duplication that requires USP33, a deubiquitinating enzyme that is able to regulate CP110 levels
22684256 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
22441691 Neurl4 counteracts accumulation of CP110, thereby maintaining normal centriolar homeostasis and preventing formation of ectopic microtubular organizing centres
21982113 Cp110 expression in mucosa from patients with chronic rhinosinusitis might contribute to the poor ciliation observed in these patients
21620453 Study found that loss of Kif24 leads to the disappearance of CP110 from mother centrioles in cycling cells able to form cilia; thus, identifying a centriolar kinesin that specifically remodels a subset of microtubules, thereby regulating cilia assembly.
More...

AA Sequence

MEEYEKFCEKSLARIQEASLSTESFLPAQSESISLIRFHGVAILSPLLNIEKRKEMQQEKQKALDVEARK      1 - 70
QVNRKKALLTRVQEILDNVQVRKAPNASDFDQWEMETVYSNSEVRNLNVPATFPNSFPSHTEHSTAAKLD     71 - 140
KIAGILPLDNEDQCKTDGIDLARDSEGFNSPKQCDSSNISHVENEAFPKTSSATPQETLISDGPFSVNEQ    141 - 210
QDLPLLAEVIPDPYVMSLQNLMKKSKEYIEREQSRRSLRGSINRIVNESHLDKEHDAVEVADCVKEKGQL    211 - 280
TGKHCVSVIPDKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTE    281 - 350
NNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGKEQAMDLIIQDTDENTN    351 - 420
VPEIMPKLPTDLAGVCSSKVYVGKNTSEVKEDVVLGKSNQVCQSSGNHLENKVTHGLVTVEGQLTSDERG    421 - 490
AHIMNSTCAAMPKLHEPYASSQCIASPNFGTVSGLKPASMLEKNCSLQTELNKSYDVKNPSPLLMQNQNT    491 - 560
RQQMDTPMVSCGNEQFLDNSFEKVKRRLDLDIDGLQKENCPYVITSGITEQERQHLPEKRYPKGSGFVNK    561 - 630
NKMLGTSSKESEELLKSKMLAFEEMRKRLEEQHAQQLSLLIAEQEREQERLQKEIEEQEKMLKEKKAMTA    631 - 700
EASELDINNAVELEWRKISDSSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSG    701 - 770
LTKLSVTRPFGRAKTRWSQVFSLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSE    771 - 840
APLKRGIVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQMDKMKSPRVA    841 - 910
LSAATQKSLDRKKYMKAAEMGMPNKKFLVKQNPSETRVLQPNQGQNAPVHRLLSRQGTPKTSVKGVVQNR    911 - 980
QKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI                                          981 - 1012
//

Text Mined References (47)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26487539 2015 MiR-129-3p promotes docetaxel resistance of breast cancer cells via CP110 inhibition.
26304236 2015 Specific CP110 Phosphorylation Sites Mediate Anaphase Catastrophe after CDK2 Inhibition: Evidence for Cooperation with USP33 Knockdown.
25808870 2015 CDK2 Inhibition Causes Anaphase Catastrophe in Lung Cancer through the Centrosomal Protein CP110.
25753040 2015 Centrin2 regulates CP110 removal in primary cilium formation.
25201258 2014 Impairment of cilia architecture and ciliogenesis in hyperplastic nasal epithelium from nasal polyps.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23486064 2013 USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...