Property Summary

NCBI Gene PubMed Count 41
PubMed Score 26.40
PubTator Score 27.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 7.6e-03
astrocytic glioma -1.600 3.0e-02
Astrocytoma, Pilocytic -1.200 5.7e-05
atypical teratoid / rhabdoid tumor -1.200 3.3e-03
Breast cancer 3.000 2.4e-02
glioblastoma -1.300 3.2e-05
oligodendroglioma -1.500 5.0e-02
osteosarcoma -1.444 3.9e-03
ovarian cancer -1.100 2.3e-05
pituitary cancer -1.700 2.3e-04
posterior fossa group A ependymoma -1.100 1.3e-05
subependymal giant cell astrocytoma -1.073 2.8e-02

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MEEYEKFCEKSLARIQEASLSTESFLPAQSESISLIRFHGVAILSPLLNIEKRKEMQQEKQKALDVEARK      1 - 70
QVNRKKALLTRVQEILDNVQVRKAPNASDFDQWEMETVYSNSEVRNLNVPATFPNSFPSHTEHSTAAKLD     71 - 140
KIAGILPLDNEDQCKTDGIDLARDSEGFNSPKQCDSSNISHVENEAFPKTSSATPQETLISDGPFSVNEQ    141 - 210
QDLPLLAEVIPDPYVMSLQNLMKKSKEYIEREQSRRSLRGSINRIVNESHLDKEHDAVEVADCVKEKGQL    211 - 280
TGKHCVSVIPDKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTE    281 - 350
NNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGKEQAMDLIIQDTDENTN    351 - 420
VPEIMPKLPTDLAGVCSSKVYVGKNTSEVKEDVVLGKSNQVCQSSGNHLENKVTHGLVTVEGQLTSDERG    421 - 490
AHIMNSTCAAMPKLHEPYASSQCIASPNFGTVSGLKPASMLEKNCSLQTELNKSYDVKNPSPLLMQNQNT    491 - 560
RQQMDTPMVSCGNEQFLDNSFEKVKRRLDLDIDGLQKENCPYVITSGITEQERQHLPEKRYPKGSGFVNK    561 - 630
NKMLGTSSKESEELLKSKMLAFEEMRKRLEEQHAQQLSLLIAEQEREQERLQKEIEEQEKMLKEKKAMTA    631 - 700
EASELDINNAVELEWRKISDSSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSG    701 - 770
LTKLSVTRPFGRAKTRWSQVFSLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSE    771 - 840
APLKRGIVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQMDKMKSPRVA    841 - 910
LSAATQKSLDRKKYMKAAEMGMPNKKFLVKQNPSETRVLQPNQGQNAPVHRLLSRQGTPKTSVKGVVQNR    911 - 980
QKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI                                          981 - 1012
//

Text Mined References (48)

PMID Year Title