Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.53
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.400 0.001
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -1.800 0.000
psoriasis -1.200 0.003
glioblastoma -3.200 0.000
group 4 medulloblastoma -3.500 0.000
cystic fibrosis 1.040 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -2.800 0.001
primitive neuroectodermal tumor -2.100 0.004
fibroadenoma -1.700 0.049
adult high grade glioma -3.000 0.000
aldosterone-producing adenoma -1.777 0.008
Pick disease -1.400 0.008
ductal carcinoma in situ -2.400 0.001
invasive ductal carcinoma -2.500 0.012
ovarian cancer -2.900 0.000

Gene RIF (5)

PMID Text
26302849 The genotype "A/G" of rs1665650 in HSPA12A gene was associated with a decreased risk of gastric cancer.
25798051 High BCLC staging scores, advanced cirrhosis and the overexpression of HSPA12A and HSP90B1 might be associated with poor survival from HCC, whereas high levels of HSPA4, HSPA5 and HSPA6 might be associated with earlier recurrence of HCC
18977241 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
15601604 We found that HSPA12A is expressed in the human brain and shows a neuron- and region-specific transcript distribution, with strongest expression in the frontal and occipital cortical regions. HSPA12A Mrna was significantly reduced in schizophrenia.

AA Sequence

MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAVDFGTTSSGY      1 - 70
AYSFTKEPECIHVMRRWEGGDPGVSNQKTPTTILLTPERKFHSFGYAARDFYHDLDPNEAKQWLYLEKFK     71 - 140
MKLHTTGDLTMDTDLTAANGKKVKALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQP    141 - 210
AKQFMRQAAYQAGLASPENSEQLIIALEPEAASIYCRKLRLHQMIELSSKAAVNGYSGSDTVGAGFTQAK    211 - 280
EHIRRNRQSRTFLVENVIGEIWSELEEGDKYVVVDSGGGTVDLTVHQIRLPEGHLKELYKATGGPYGSLG    281 - 350
VDYEFEKLLYKIFGEDFIEQFKIKRPAAWVDLMIAFESRKRAAAPDRTNPLNITLPFSFIDYYKKFRGHS    351 - 420
VEHALRKSNVDFVKWSSQGMLRMSPDAMNALFKPTIDSIIEHLRDLFQKPEVSTVKFLFLVGGFAEAPLL    421 - 490
QQAVQAAFGDQCRIIIPQDVGLTILKGAVLFGLDPAVIKVRRSPLTYGVGVLNRYVEGKHPPEKLLVKDG    491 - 560
TRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTG    561 - 630
TSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGIDFLNY                             631 - 675
//

Text Mined References (20)

PMID Year Title
26302849 2015 Polymorphisms of PRLHR and HSPA12A and risk of gastric and colorectal cancer in the Chinese Han population.
25798051 2015 Upregulation of heat shock proteins (HSPA12A, HSP90B1, HSPA4, HSPA5 and HSPA6) in tumour tissues is associated with poor outcomes from HBV-related early-stage hepatocellular carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
More...