Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.92
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.600 1.1e-02
intraductal papillary-mucinous adenoma (... 1.200 1.4e-04
intraductal papillary-mucinous carcinoma... 1.400 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.1e-02
lung cancer -1.400 1.4e-03
medulloblastoma, large-cell -1.100 1.0e-03
osteosarcoma 3.097 1.6e-09
Pick disease 1.100 2.9e-04
psoriasis 1.900 6.6e-04
Rheumatoid arthritis 1.100 2.1e-02
spina bifida -1.749 3.0e-02

Gene RIF (1)

AA Sequence

MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRI      1 - 70
VLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCTEVLEGNPTVLCQKLNHGSDH     71 - 140
QSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEM    141 - 210
ASQDGEEGASDSAEFHYTRPMYSKPSIMAHKRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEH    211 - 280
TVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSEN    281 - 350
IEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK    351 - 420
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN                           421 - 467
//

Text Mined References (15)

PMID Year Title