Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.82
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.57578330700534E-9
intraductal papillary-mucinous adenoma (IPMA) 2956 1.44769889717101E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.34064269494841E-4
Pick disease 1893 2.92484406956394E-4
psoriasis 6685 6.61235991385618E-4
medulloblastoma, large-cell 6234 0.00104589212326529
lung cancer 4473 0.00136722657827841
acute myeloid leukemia 785 0.0107023250918742
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0160135861090476
Rheumatoid Arthritis 1171 0.0209754853004844
spina bifida 1064 0.030290597794364
Disease Target Count Z-score Confidence
Muscular atrophy 67 3.34 1.7

Expression

  Differential Expression (11)

Synonym

Accession O43298 Q5JU96
Symbols ZNF-X
ZBTB22B
ZNF297B

Gene

PDB

2CSH  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
19847924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRI      1 - 70
VLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCTEVLEGNPTVLCQKLNHGSDH     71 - 140
QSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEM    141 - 210
ASQDGEEGASDSAEFHYTRPMYSKPSIMAHKRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEH    211 - 280
TVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSEN    281 - 350
IEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK    351 - 420
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN                           421 - 467
//

Text Mined References (14)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19847924 2010 Detecting rare variants for complex traits using family and unrelated data.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16542149 2006 The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...