Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.80
PubTator Score 0.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 4.4e-02
medulloblastoma, large-cell -1.100 3.5e-03
osteosarcoma 2.019 7.1e-06
ovarian cancer -1.500 3.5e-07
pancreatic cancer 1.100 9.8e-03
Pick disease 1.500 2.3e-05
primary pancreatic ductal adenocarcinoma 1.107 1.1e-02

AA Sequence

MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKAELICHLEHGQ      1 - 70
EPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHF     71 - 140
RPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGDRVRSHNSCESGKDPMIQEEENNFKCSECGK    141 - 210
VFNKKHLLAGHEKIHSGVKPYECTECGKTFIKSTHLLQHHMIHTGERPYECMECGKAFNRKSYLTQHQRI    211 - 280
HSGEKPYKCNECGKAFTHRSNFVLHNRRHTGEKSFVCTECGQVFRHRPGFLRHYVVHSGENPYECLECGK    281 - 350
VFKHRSYLMWHQQTHTGEKPYECSECGKVFLESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRI    351 - 420
HTGEKPFVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGEKPYECVECGK    421 - 490
AFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHAIIHTGEKPYKCSECGKAFSRSSSLTQHQRM    491 - 560
HTGKNPISVTDVGRPFTSGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL       561 - 627
//

Text Mined References (12)

PMID Year Title