Property Summary

NCBI Gene PubMed Count 74
Grant Count 73
R01 Count 45
Funding $5,145,508.82
PubMed Score 82.21
PubTator Score 77.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43294 B2R8D5 Q9BPW3 Q9Y2V5
Symbols HIC5
ARA55
HIC-5
TSC-5

Gene

Gene RIF (37)

PMID Text
26416447 Hic-5 plays a central role in the positive feedback ROS-JNK signaling cascade that regulates hepatocellular carcinoma progression.
26313302 Hic-5 siRNA also suppressed TGF-beta2-induced fibrogenic activity and dexamethasone-induced myocilin expression in HTM cells.
25763609 Hic-5 influences the genomic occupancy of multiple steroid receptors and thereby blocks some aspects of hormonal regulation.
25587044 Endothelial Hic-5 plays an important role in the formation of microvilli-like structures and in the interaction between ECs and monocytes, leading to monocyte recruitment and subsequent development of atherosclerosis.
25333259 Studies in vitro and in vivo using TGF-beta1 and TGFB1I1 shRNA demonstrated that TGFB1I1 is required for TGF-beta stimulated EMT that contributes to malignant progression of astrocytomas.
24831009 Hic-5 suppresses senescence and profibrotic activities of myofibroblasts by down-regulating Nox4 expression.
24440747 Hic5 coordinates AR signaling with adhesion and extracellular matrix contacts to regulate cell behavior in the tumor microenvironment.
23145173 The ubiquitin ligase activity of Cbl-c by the direct interaction of the LIM zinc coordinating domain of Hic5 is demonstrated.
23062781 Hic-5 can potentially exercise multiple functions in growth, differentiation, migration and adhesion of keratinocytes, partially via nuclear-cell membrane shuttling.
23007394 the HIC-5- and KLF4-dependent mechanism transactivates p21(Cip1) in response to anchorage loss
More...

AA Sequence

MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPK      1 - 70
PAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPS     71 - 140
SPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGL    141 - 210
LQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYF    211 - 280
ERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQ    281 - 350
GPILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL    351 - 420
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG                                 421 - 461
//

Text Mined References (98)

PMID Year Title
26416447 2015 Hydrogen peroxide inducible clone-5 mediates reactive oxygen species signaling for hepatocellular carcinoma progression.
26313302 2015 Hic-5 Regulates Actin Cytoskeletal Reorganization and Expression of Fibrogenic Markers and Myocilin in Trabecular Meshwork Cells.
25763609 2015 Selective coregulator function and restriction of steroid receptor chromatin occupancy by Hic-5.
25587044 2015 Role of Hic-5 in the formation of microvilli-like structures and the monocyte-endothelial interaction that accelerates atherosclerosis.
25333259 2014 Multidimensional analysis of gene expression reveals TGFB1I1-induced EMT contributes to malignant progression of astrocytomas.
24831009 2014 Negative regulation of NADPH oxidase 4 by hydrogen peroxide-inducible clone 5 (Hic-5) protein.
24440747 2014 Hic-5 influences genomic and non-genomic actions of the androgen receptor in prostate myofibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145173 2012 Cbl-c ubiquitin ligase activity is increased via the interaction of its RING finger domain with a LIM domain of the paxillin homolog, Hic 5.
More...