Property Summary

NCBI Gene PubMed Count 39
Grant Count 20
R01 Count 17
Funding $1,561,924.19
PubMed Score 50.89
PubTator Score 692.66

Knowledge Summary

Patent (17,139)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
osteosarcoma 1.604 0.001
Gaucher disease type 1 -1.200 0.017

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
26748242 The results revealed mutations caused a significant structural variation in DAPK3, concentrated in flexible loops forming part of the ATP binding pocket which have been associated with very low kinase activity, and the cellular progression towards cancer
26117336 DAPK3 plays a central role in preventing miR-17/miR-20a depletion-induced genome instability and in miR-17/miR-20a overexpression-triggered tumor formation.
25769953 findings suggest that ZIPK plays a role in the progression and completion of cytokinesis through MRLC phosphorylation
25723491 ROCK1 and ZIPK have diverse, but predominantly distinct regulatory functions in vascular SMC and that ROCK1-mediated activation of ZIPK is not involved in most of these functions.
25503649 These findings indicated that ZIPK may also be involved in the regulation of the cell cycle in human cells, by interacting with HsCdc14A.
25304685 Cellular and mouse modeling studies show that DAPK3 is a tumor suppressor gene and is important in early development. Also, its expression is downregulated in more aggressive breast cancer relative to less aggressive and normal patient samples.
24633547 Depletion of ZIPK resulted in impairment of cultured VSMC migration and contraction.
23454120 Interaction of RhoD and ZIP kinase modulates actin filament assembly and focal adhesion dynamics.
23146908 ZIPK has a crucial role in regulation of ubiquitination and degradation of the AR
21487036 Results suggest that DAPK3 is a tumor suppressor in which loss-of-function mutations promote increased cell survival, proliferation, cellular aggregation.
More...

AA Sequence

MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILRE      1 - 70
IRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDL     71 - 140
KPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL    141 - 210
LSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRR    211 - 280
RNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCH    281 - 350
EDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY    351 - 420
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR                                        421 - 454
//

Text Mined References (51)

PMID Year Title
26748242 2016 Biophysical changes of ATP binding pocket may explain loss of kinase activity in mutant DAPK3 in cancer: A molecular dynamic simulation analysis.
26117336 2015 Oncogenic miR-17/20a Forms a Positive Feed-forward Loop with the p53 Kinase DAPK3 to Promote Tumorigenesis.
25769953 2015 Phosphorylation of myosin II regulatory light chain by ZIP kinase is responsible for cleavage furrow ingression during cell division in mammalian cultured cells.
25723491 2015 The effects of knockdown of rho-associated kinase 1 and zipper-interacting protein kinase on gene expression and function in cultured human arterial smooth muscle cells.
25503649 2015 Zipper-interacting protein kinase interacts with human cell division cycle 14A phosphatase.
25304685 2015 DAPK3 suppresses acini morphogenesis and is required for mouse development.
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24633547 2014 ZIPK is critical for the motility and contractility of VSMCs through the regulation of nonmuscle myosin II isoforms.
23454120 2013 Interaction of RhoD and ZIP kinase modulates actin filament assembly and focal adhesion dynamics.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
More...