Property Summary

Ligand Count 8
NCBI Gene PubMed Count 42
PubMed Score 50.71
PubTator Score 692.66

Knowledge Summary

Patent (17,139)

Expression

  Differential Expression (3)

Disease log2 FC p
Gaucher disease type 1 -1.200 1.7e-02
malignant mesothelioma -2.000 1.6e-05
osteosarcoma 1.604 9.4e-04

Gene RIF (22)

AA Sequence

MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILRE      1 - 70
IRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDL     71 - 140
KPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL    141 - 210
LSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRR    211 - 280
RNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCH    281 - 350
EDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY    351 - 420
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR                                        421 - 454
//

Text Mined References (54)

PMID Year Title