Property Summary

NCBI Gene PubMed Count 57
PubMed Score 182.35
PubTator Score 101.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Pain agnosia 104 4.049 2.0
Diarrhea 253 3.763 1.9
Cancer 2499 3.041 1.5

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.900 2.7e-05
astrocytic glioma -2.200 2.3e-03
Astrocytoma, Pilocytic -1.900 8.1e-08
breast carcinoma 1.700 4.4e-03
ductal carcinoma in situ 2.800 2.0e-03
ependymoma -2.400 3.9e-03
fibroadenoma 2.300 4.1e-02
glioblastoma -2.100 2.2e-10
group 3 medulloblastoma -2.800 7.8e-06
interstitial cystitis -1.400 5.0e-02
intraductal papillary-mucinous carcinoma... 1.300 7.4e-04
invasive ductal carcinoma 3.100 7.3e-03
lung adenocarcinoma 1.264 1.5e-05
lung cancer 1.100 3.7e-02
medulloblastoma, large-cell -1.800 2.2e-04
oligodendroglioma -2.100 6.4e-03
osteosarcoma -2.401 2.0e-03
ovarian cancer 2.200 2.7e-04
pancreatic ductal adenocarcinoma liver m... 2.320 3.0e-02
primitive neuroectodermal tumor -1.100 3.2e-02

Gene RIF (42)

AA Sequence

MAQLCGLRRSRAFLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGG      1 - 70
CDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTG     71 - 140
PCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLI    141 - 210
LFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL                                211 - 252
//

Text Mined References (59)

PMID Year Title