Property Summary

NCBI Gene PubMed Count 54
Grant Count 39
R01 Count 15
Funding $3,899,167.02
PubMed Score 163.83
PubTator Score 101.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -2.200 0.002
ependymoma -2.400 0.004
oligodendroglioma -2.100 0.006
glioblastoma -2.500 0.000
osteosarcoma -2.401 0.002
group 3 medulloblastoma -2.800 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.032
pancreatic ductal adenocarcinoma liver m... 2.320 0.030
intraductal papillary-mucinous carcinoma... 1.300 0.001
lung cancer 1.100 0.037
breast carcinoma 1.700 0.004
fibroadenoma 2.300 0.041
interstitial cystitis -1.800 0.000
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -1.800 0.000
lung adenocarcinoma 1.264 0.000
ductal carcinoma in situ 2.800 0.002
invasive ductal carcinoma 3.100 0.007
ovarian cancer 2.200 0.000

Gene RIF (39)

PMID Text
26442953 It suggests an involvement of SPINT2 in PCa tumorigenesis, probably in association with a post-translational regulation of SPINT2.
26171609 N-glycan branching regulates HAI-2 through different subcellular distribution and subsequently access to different target proteases
26030814 study the methylation status of the promoter region of Serine peptidase inhibitor/hepatocyte growth factor activator inhibitor type 2 (SPINT2/HAI-2)
25910030 Epigenetic silencing of SPINT2 promotes cancer cell motility in malignant melanoma.
25786220 Matriptase inhibition by HAI-2 requires the translocation of HAI-2 to the cell surface, a process which is observed in some breast cancer cells but not in mammary epithelial cells.
24722141 a missense mutation in the serine protease inhibitor SPINT2 may have a role in congenital sodium diarrhea
24410667 results suggest that the SPINT2 underexpression in the MSC from MDS patients is probably involved in the adhesion of progenitors to the bone marrow niche, through an increased HGF and SDF-1 signaling pathway.
24269829 The tumor suppressor gene SPINT2 is commonly silenced by promoter hypermethylation in human esophageal squamous cell carcinoma and SPINT2 hypermethylation is correlated with poor overall survival.
24142340 established SPINT2 as a second gene associated with congenital tufting enteropathy
24121274 The role of hepatocyte growth factor activator inhibitor-2 (HAI-2) in prostate cancer cell migration, invasion, tumorigenicity and metastasis.
More...

AA Sequence

MAQLCGLRRSRAFLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGG      1 - 70
CDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTG     71 - 140
PCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLI    141 - 210
LFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL                                211 - 252
//

Text Mined References (56)

PMID Year Title
26442953 2016 SPINT2 Deregulation in Prostate Carcinoma.
26171609 2015 N-Glycan Branching Affects the Subcellular Distribution of and Inhibition of Matriptase by HAI-2/Placental Bikunin.
26030814 2015 Aberrant methylation of promoter region of SPINT2/HAI-2 gene: an epigenetic mechanism in hepatitis C virus-induced hepatocarcinogenesis.
25910030 2015 Epigenetic Silencing of SPINT2 Promotes Cancer Cell Motility via HGF-MET Pathway Activation in Melanoma.
25786220 2015 Differential subcellular localization renders HAI-2 a matriptase inhibitor in breast cancer cells but not in mammary epithelial cells.
24722141 2014 Functional analysis of a missense mutation in the serine protease inhibitor SPINT2 associated with congenital sodium diarrhea.
24410667 2014 Serine protease inhibitor kunitz-type 2 is downregulated in myelodysplastic syndromes and modulates cell-cell adhesion.
24269829 2014 Epigenetic inactivation of SPINT2 is associated with tumor suppressive function in esophageal squamous cell carcinoma.
24142340 2014 Genetic characterization of congenital tufting enteropathy: epcam associated phenotype and involvement of SPINT2 in the syndromic form.
24121274 2014 HAI-2 suppresses the invasive growth and metastasis of prostate cancer through regulation of matriptase.
More...