Property Summary

NCBI Gene PubMed Count 11
PubMed Score 75.80
PubTator Score 29.01

Knowledge Summary

Patent (8,268)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.72040045367737E-14
posterior fossa group B ependymoma 1530 3.41039320040681E-13
lung carcinoma 2844 9.75998106501748E-13
glioblastoma 5572 8.950054416764E-7
atypical teratoid / rhabdoid tumor 4369 3.04331675152809E-6
pediatric high grade glioma 2712 1.51718015343352E-5
osteosarcoma 7933 2.13425345502697E-5
lung cancer 4473 6.66049252386274E-5
ovarian cancer 8492 9.2769365415546E-5
group 4 medulloblastoma 1875 3.48274798132986E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.58233459489641E-4
subependymal giant cell astrocytoma 2287 0.0123003751051721
medulloblastoma, large-cell 6234 0.0181657288214489
Breast cancer 3099 0.0431538712996683
Disease Target Count Z-score Confidence
Alexander disease 9 3.935 2.0
Parkinson's disease 364 3.337 1.7

Expression

  Differential Expression (14)

Synonym

Accession O43283 B2R6U2 B4DLE3 B4DMV2 B4DZJ4 D3DNU1 Q05BY6 Q15450 Q2NKN3
Symbols LZK
MLK
MEKK13

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12186766 Chromosomal localization studies involving FISH mapping demonstrated that the human LZK gene is located at 3q27.

AA Sequence

MANFQEHLSCSSSPHLPFSESKTFNGLQDELTAMGNHPSPKLLEDQQEKGMVRTELIESVHSPVTTTVLT      1 - 70
SVSEDSRDQFENSVLQLREHDESETAVSQGNSNTVDGESTSGTEDIKIQFSRSGSGSGGFLEGLFGCLRP     71 - 140
VWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQGAVFLGKFRAEEVAIKKVREQNETDIKHLRK    141 - 210
LKHPNIIAFKGVCTQAPCYCIIMEYCAHGQLYEVLRAGRKITPRLLVDWSTGIASGMNYLHLHKIIHRDL    211 - 280
KSPNVLVTHTDAVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE    281 - 350
IPYKDVDSSAIIWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTLMHLDIASADVLATPQE    351 - 420
TYFKSQAEWREEVKKHFEKIKSEGTCIHRLDEELIRRRREELRHALDIREHYERKLERANNLYMELSAIM    421 - 490
LQLEMREKELIKREQAVEKKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSEGIPTT    491 - 560
EVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAILKNQPAQENSPHPTYLHQAQSQYPS    561 - 630
LHHHNSLQQQYQQPPPAMSQSHHPRLNMHGQDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLIS    631 - 700
TAMAADCWRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENA    701 - 770
QSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCIS    771 - 840
SCQSYSTFSSENFSVSDGEEGNTSDHSNSPDELADKLEDRLAEKLDDLLSQTPEIPIDISSHSDGLSDKE    841 - 910
CAVRRVKTQMSLGKLCVEERGYENPMQFEESDCDSSDGECSDATVRTNKHYSSATW                  911 - 966
//

Text Mined References (13)

PMID Year Title
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12492477 2003 Mixed lineage kinase LZK and antioxidant protein-1 activate NF-kappaB synergistically.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12186766 2002 Genomic organization and fine-mapping of the human leucine zipper-bearing kinase (LZK) gene.
11726277 2001 Mixed lineage kinase LZK forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway.
More...