Property Summary

NCBI Gene PubMed Count 13
Grant Count 99
R01 Count 62
Funding $22,844,542.64
PubMed Score 1142.60
PubTator Score 496.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
oligodendroglioma 2.300 0.008
esophageal adenocarcinoma -2.400 0.018
cutaneous lupus erythematosus -1.200 0.037
psoriasis -1.100 0.001
ependymoma 1.600 0.000
glioblastoma 2.400 0.000
medulloblastoma 2.600 0.000
cystic fibrosis -1.165 0.000
astrocytoma 2.000 0.010
atypical teratoid / rhabdoid tumor 1.100 0.003
medulloblastoma, large-cell 2.000 0.001
primitive neuroectodermal tumor 2.300 0.000
non-small cell lung cancer 1.291 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.001
intraductal papillary-mucinous carcinoma... -1.100 0.002
colon cancer -2.900 0.014
lung cancer -2.500 0.000
interstitial cystitis -1.200 0.001
adult high grade glioma 1.900 0.002
pilocytic astrocytoma 2.000 0.000
ovarian cancer 2.000 0.000
pituitary cancer 1.400 0.014

Synonym

Accession O43281 B2RAJ7 B4DJ56 E9PGU2 O43282 hEFS
Symbols SIN
CAS3
EFS1
EFS2
HEFS
CASS3

Gene

EFS

Gene RIF (4)

PMID Text
26119091 EFS and CASS4 protein function in the context of the larger CAS family group. [Review]
25296736 we suggest that EFS should be considered as a novel tumor suppressor gene in prostate cancer.
21871071 Analysis of 16 Uveal melanoma showed full methylation of the EFS CpG island in 8 (50%), no methylation in 5(31%)and partial methylation in 3 (19%)tumors. Kaplan-Meier analysis revealed higher risk of metastatic progression for tumors with EFS methylation.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAIATSTQLARALYDNTAESPQELSFRRGDVLRVLQREGAGGLDGWCLCSLHGQQGIVPANRVKLLPAGP      1 - 70
APKPSLSPASPAQPGSPYPAPDHSNEDQEVYVVPPPARPCPTSGPPAGPCPPSPDLIYKIPRASGTQLAA     71 - 140
PRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGR    141 - 210
EPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTL    211 - 280
AQLLARSPPPPHRPRLPSAESLSRRPLPALPVPEAPSPSPVPSPAPGRKGSIQDRPLPPPPPRLPGYGGP    281 - 350
KVEGDPEGREMEDDPAGHHNEYEGIPMAEEYDYVHLKGMDKAQGSRPPDQACTGDPELPERGMPAPQEAL    351 - 420
SPGEPLVVSTGDLQLLYFYAGQCQSHYSALQAAVAALMSSTQANQPPRLFVPHSKRVVVAAHRLVFVGDT    421 - 490
LGRLAASAPLRAQVRAAGTALGQALRATVLAVKGAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLA    491 - 560
P//

Text Mined References (16)

PMID Year Title
26119091 2015 Embryonal Fyn-associated substrate (EFS) and CASS4: The lesser-known CAS protein family members.
25416956 2014 A proteome-scale map of the human interactome network.
25296736 2015 Decreased expression of EFS is correlated with the advanced prostate cancer.
21871071 2011 EFS shows biallelic methylation in uveal melanoma with poor prognosis as well as tissue-specific methylation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...