Property Summary

NCBI Gene PubMed Count 17
Grant Count 56
R01 Count 23
Funding $10,678,784.94
PubMed Score 136.47
PubTator Score 223.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
chronic kidney disease -1.100 0.045
active Crohn's disease -1.181 0.011

Gene RIF (5)

PMID Text
26156397 results suggest a significant association between the RETL1, TREH, and PHLDB1 genes and GBM development in the Han Chinese population
23468175 variants in TREH control trehalase activity, and although one of these variants is also reproducibly associated with T2D, it is likely that the effect of the SNP on risk of T2D occurs by a mechanism different than affecting trehalase activity.
22369735 we found three protective alleles for glioma patients, including the allele ''T'' of rs17748 in the TREH gene by recessive model (OR, 0.48; 95% CI, 0.23-1.01; P = 0.05) analysis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19126402 These results suggest that TREH acts as a stress-response protein in the kidney rather than involved in utilization of exogenous trehalose.

AA Sequence

MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLSIAPEQVLQTF      1 - 70
TELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGK     71 - 140
KMKPEVLSHPERFSLIYSEHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMAETVKGMLQNFLDLVKTYGHV    141 - 210
PNGGRVYYLQRSQPPLLTLMMDCYLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYV    211 - 280
PYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLN    281 - 350
AFLCQAEELMSNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTP    351 - 420
LWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEV    421 - 490
AFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKL    491 - 560
AFLEPHCLAATLLPSLLLSLLPW                                                   561 - 583
//

Text Mined References (18)

PMID Year Title
26156397 2015 Association between RTEL1, PHLDB1, and TREH Polymorphisms and Glioblastoma Risk: A Case-Control Study.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
23468175 2013 Identification of genetic variation that determines human trehalase activity and its association with type 2 diabetes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22369735 2012 Polymorphisms of TREH, IL4R and CCDC26 genes associated with risk of glioma.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19126402 2009 Human trehalase is a stress responsive protein in Saccharomyces cerevisiae.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...