Property Summary

Ligand Count 1
NCBI Gene PubMed Count 18
PubMed Score 137.41
PubTator Score 223.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.181 1.1e-02
chronic kidney disease -1.100 4.5e-02

Gene RIF (6)

AA Sequence

MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLSIAPEQVLQTF      1 - 70
TELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGK     71 - 140
KMKPEVLSHPERFSLIYSEHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMAETVKGMLQNFLDLVKTYGHV    141 - 210
PNGGRVYYLQRSQPPLLTLMMDCYLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYV    211 - 280
PYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLN    281 - 350
AFLCQAEELMSNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTP    351 - 420
LWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEV    421 - 490
AFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKL    491 - 560
AFLEPHCLAATLLPSLLLSLLPW                                                   561 - 583
//

Text Mined References (19)

PMID Year Title