Property Summary

NCBI Gene PubMed Count 62
Grant Count 14
R01 Count 10
Funding $1,109,833.54
PubMed Score 77.23
PubTator Score 101.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
26166362 it was found that the recombinant fusion protein uPA17-34-KPI (kunitz-type protease inhibitor ) inhibited the invasion and metastasis of ovarian tumors
26165838 The findings suggest that the oncogenic activity of hepsin arises not only from elevated expression level but also from depletion of HAI-1, events which together trigger gain-of-function activity impacting HGF/MET signalling and epithelial cohesion
25925948 the anti-migratory effects seen via gamma-catenin were driven by the expression of hepatocyte growth factor activator inhibitor Type I (HAI-1 or SPINT-1), an upstream inhibitor of the c-MET signaling pathway.
25842366 HAI-1 may have a critical role in maintaining normal keratinocyte morphology through regulation of PAR-2-dependent p38 mitogen-activated protein kinase signaling.
25510835 Data suggest HAI1 exhibits structural features consistent with classification in MANEC subclass of PAN/apple domain family with unifying features such as two additional disulfide bonds, two extended loop regions, and additional alpha-helical elements.
24659667 The results of the present study identified HAI-1 as a favorable prognostic marker for prostate cancer and may indicate that HAI-1 could be a therapeutic target for the treatment of this malignancy.
24147538 Matriptase activity was suppressed by the expression of HAI-1.
23979832 HAI-1 expression correlates with the differentiation status of colorectal epithelia and could serve as a differentiation marker.
23443661 Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1
23409135 HAI-1 and HAI-2 influence proliferation and cell fate of NPCs and their expression levels are linked to BMP sign
More...

AA Sequence

MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS      1 - 70
NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY     71 - 140
LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL    141 - 210
WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY    211 - 280
GGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDS    281 - 350
FLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT    351 - 420
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKN    421 - 490
QRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL                                   491 - 529
//

Text Mined References (63)

PMID Year Title
26166362 2015 Expression and activity analysis of a new fusion protein targeting ovarian cancer cells.
26165838 2016 Deregulated hepsin protease activity confers oncogenicity by concomitantly augmenting HGF/MET signalling and disrupting epithelial cohesion.
25925948 2015 Novel Role for ?-Catenin in the Regulation of Cancer Cell Migration via the Induction of Hepatocyte Growth Factor Activator Inhibitor Type 1 (HAI-1).
25842366 2015 Hepatocyte growth factor activator inhibitor type 1 maintains the assembly of keratin into desmosomes in keratinocytes by regulating protease-activated receptor 2-dependent p38 signaling.
25510835 2015 The solution structure of the MANEC-type domain from hepatocyte growth factor activator inhibitor-1 reveals an unexpected PAN/apple domain-type fold.
24659667 Expression of hepatocyte growth factor activator inhibitor-1 (HAI-1) gene in prostate cancer: clinical and biological significance.
24147538 2014 Loss of hepatocyte growth factor activator inhibitor type 1 participates in metastatic spreading of human pancreatic cancer cells in a mouse orthotopic transplantation model.
23979832 2013 Down-regulation of HAI-1 is associated with poor-differentiation status of colorectal cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23443661 2013 Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
More...