Property Summary

NCBI Gene PubMed Count 69
PubMed Score 86.59
PubTator Score 101.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ductal carcinoma in situ 1.900 2.2e-03
facioscapulohumeral dystrophy 3.300 1.9e-06
fibroadenoma 1.300 4.7e-02
interstitial cystitis -1.600 2.8e-02
intraductal papillary-mucinous carcinoma... 1.300 9.4e-04
intraductal papillary-mucinous neoplasm ... 1.800 8.7e-04
invasive ductal carcinoma 1.900 1.0e-02
lung adenocarcinoma 1.501 2.6e-06
lung cancer 1.600 2.3e-04
malignant mesothelioma -2.000 2.5e-07
pancreatic ductal adenocarcinoma liver m... 1.667 2.0e-02
psoriasis -1.600 2.6e-04
spina bifida -1.289 3.9e-02
ulcerative colitis -1.200 1.8e-04

Gene RIF (48)

AA Sequence

MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS      1 - 70
NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY     71 - 140
LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL    141 - 210
WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY    211 - 280
GGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDS    281 - 350
FLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT    351 - 420
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKN    421 - 490
QRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL                                   491 - 529
//

Text Mined References (70)

PMID Year Title