Property Summary

NCBI Gene PubMed Count 36
PubMed Score 41.46
PubTator Score 31.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
osteosarcoma 7950 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 8.3e-08
lung cancer 4740 6.3e-04
colon cancer 1478 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Roberts syndrome 15 4.483 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 4.0e-02
lung cancer 1.500 6.3e-04
malignant mesothelioma 1.800 8.3e-08

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDI      1 - 70
DLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTGAQRLEE     71 - 140
AQKCLKLLKSRKCFDLKILKSLSMELTIQKQNILYHLGEEWQKLIVWKFPPSKDTSSLESYLQTELHLYT    141 - 210
EQSHKEEKTPMPPISSVLLAFSVLGELHSKLKSFGQMLLKYILRPLASCPSLHAVIESQPNIVIIRFESI    211 - 280
MTNLEYPSPSEVFTKIRLVLEVLQKQLLDLPLDTDLENEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYS    281 - 350
IPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIH    351 - 420
NTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELA    421 - 490
YQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFR    491 - 560
LRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVL    561 - 630
HQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALEDISTEDGDRLYSLCKTVMDEGPQVFAPL    631 - 700
SEESKNKKYQEEVPVYVPKWMPFKELMMMLQASLQEIGDRWADGKGPLAAAFSSSEVKALIRALFQNTER    701 - 770
RAAALAKIK                                                                 771 - 779
//

Text Mined References (43)

PMID Year Title