Property Summary

NCBI Gene PubMed Count 36
Grant Count 44
R01 Count 34
Funding $6,185,078
PubMed Score 40.50
PubTator Score 31.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
colon cancer 1.100 0.040
lung cancer 1.500 0.001

 GO Function (1)

Gene RIF (13)

PMID Text
25849506 The RZZ complex was purified to homogeneity and subjected to systemic crystallization.
21345172 hZwint-1 bridges the inner and outer kinetochore: identification of the kinetochore localization domain and the hZw10-interaction domain
19369418 Results together suggest that NAG links between p31 and ZW10-RINT-1 and is involved in Golgi-to-ER transport.
18782227 The interaction between ZW10 and dynamitin showed that the N-terminal region of ZW10 is the major binding site for dynamitin and, like full-length ZW10, could move along microtubules to the centrosomal area in a dynein-dynactin-dependent manner.
18268100 Stable hZW10 kinetochore residency at prometaphase kinetochores is dependent on its interaction with hZwint-1, and is essential for mitotic checkpoint arrest.
18065224 Accumulation of ZW10 at tensionless kinetochores stems from a 4-fold reduction of kinetochore turnover rate and requires aurora B kinase activity.
17699596 Rab6 regulates distinct Golgi trafficking pathways involving two separate protein complexes: ZW10/RINT-1 and COG.
17680027 RNAi-mediated depletion of ZW10 markedly-reduced congression efficiency.
17560939 targeting of ZW10 to the perinuclear Golgi region was found to depend on the perinuclear accumulation of dynactin
16571679 RINT-1 coordinates the localization and function of ZW10 by serving as a link between ZW10 and the SNARE complex comprising syntaxin 18.
More...

AA Sequence

MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDI      1 - 70
DLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTGAQRLEE     71 - 140
AQKCLKLLKSRKCFDLKILKSLSMELTIQKQNILYHLGEEWQKLIVWKFPPSKDTSSLESYLQTELHLYT    141 - 210
EQSHKEEKTPMPPISSVLLAFSVLGELHSKLKSFGQMLLKYILRPLASCPSLHAVIESQPNIVIIRFESI    211 - 280
MTNLEYPSPSEVFTKIRLVLEVLQKQLLDLPLDTDLENEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYS    281 - 350
IPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIH    351 - 420
NTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELA    421 - 490
YQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFR    491 - 560
LRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVL    561 - 630
HQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALEDISTEDGDRLYSLCKTVMDEGPQVFAPL    631 - 700
SEESKNKKYQEEVPVYVPKWMPFKELMMMLQASLQEIGDRWADGKGPLAAAFSSSEVKALIRALFQNTER    701 - 770
RAAALAKIK                                                                 771 - 779
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849506 2015 Complex assembly, crystallization and preliminary X-ray crystallographic analysis of the human Rod-Zwilch-ZW10 (RZZ) complex.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21345172 2011 hZwint-1 bridges the inner and outer kinetochore: identification of the kinetochore localization domain and the hZw10-interaction domain.
21269460 2011 Initial characterization of the human central proteome.
20462495 2010 Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
20163571 2010 Rab33b and Rab6 are functionally overlapping regulators of Golgi homeostasis and trafficking.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...