Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $229,280.67
PubMed Score 53.79
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

PMID Text
23593011 we describe an example where two lncRNA genes (DLEU1 and DLEU2) are epigenetically deregulated together with a cluster of neighboring protein-coding tumor suppressor genes in almost all patients suffering from chronic lymphocytic leukemia
19347735 propose that the underlying pathomechanism of CLL involves co-regulation of miRNA genes miR-16-1 and miR-15a by the two long non-coding RNA genes DLEU1 and DLEU2.
19260139 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
11406609 Leu1 seems to be only one of the smallest splicing variants of a large gene termed BCMS.

AA Sequence

MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKE      1 - 70
EIDDSIFY                                                                   71 - 78
//

Text Mined References (16)

PMID Year Title
23593011 2013 Epigenetic upregulation of lncRNAs at 13q14.3 in leukemia is linked to the In Cis downregulation of a gene cluster that targets NF-kB.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
19347735 2009 Chronic lymphocytic leukemia and 13q14: miRs and more.
19260139 2009 Genome-wide association study of anthropometric traits in Korcula Island, Croatia.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...