Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.92
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 0.000

Synonym

Accession O43257 Q6IB12
Symbols CG1I
ZNFN4A1

Gene

Gene RIF (2)

PMID Text
17700068 Study reports that p18(Hamlet) can also mediate the cell cycle arrest induced in response to gamma-irradiation, by participating in the p53-dependent upregulation of the cell cycle inhibitor p21(Cip1) (CDKN1A).
17380123 p18(Hamlet) is a new cell-fate regulator that links the p38 MAPK and p53 pathways and contributes to the establishment of p53-regulated stress responses.

AA Sequence

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKK      1 - 70
TRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRC     71 - 140
LGTHQETRCLKWTV                                                            141 - 154
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20473270 2010 Essential role of p18Hamlet/SRCAP-mediated histone H2A.Z chromatin incorporation in muscle differentiation.
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
17892483 2007 A zinc finger HIT domain-containing protein, ZNHIT-1, interacts with orphan nuclear hormone receptor Rev-erbbeta and removes Rev-erbbeta-induced inhibition of apoCIII transcription.
17700068 2007 p18(Hamlet) mediates different p53-dependent responses to DNA-damage inducing agents.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17380123 2007 A new p38 MAP kinase-regulated transcriptional coactivator that stimulates p53-dependent apoptosis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
More...