Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.04
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 2.2e-05

Gene RIF (2)

AA Sequence

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKK      1 - 70
TRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRC     71 - 140
LGTHQETRCLKWTV                                                            141 - 154
//

Text Mined References (16)

PMID Year Title