Property Summary

NCBI Gene PubMed Count 28
PubMed Score 270.44
PubTator Score 18.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.89008983754706E-7
ovarian cancer 8492 1.17051613149493E-5
osteosarcoma 7933 1.7144063000678E-5
lung cancer 4473 5.87225362442682E-5
psoriasis 6685 2.19350769249316E-4
Waldenstrons macroglobulinemia 765 0.0192818962253892
Multiple myeloma 1328 0.0207171565548744
Breast cancer 3099 0.0282661739735793
medulloblastoma, large-cell 6234 0.0294301501338392
Disease Target Count Z-score Confidence
Spondyloepimetaphyseal dysplasia 9 3.635 1.8
Cancer 2346 3.23 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.104 0.019
Multiple myeloma 1.177 0.021
malignant mesothelioma -1.700 0.000
psoriasis 1.300 0.000
osteosarcoma 1.731 0.000
medulloblastoma, large-cell 1.100 0.029
lung cancer 1.500 0.000
Breast cancer 2.300 0.028
ovarian cancer 2.600 0.000

Synonym

Accession O43252 O43841 O75332 Q96FB1 Q96TF4 Q9P1P9 Q9UE98 PAPS synthase 1
Symbols SK1
PAPSS
ATPSK1

Gene

PANTHER Protein Class (2)

PDB

1X6V   1XJQ   1XNJ   2OFW   2OFX   2PEY   2PEZ   2QJF  

  Ortholog (2)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG

Gene RIF (16)

PMID Text
25948711 These data indicate that knocking down PAPSS increases UGT2B4 transcription and mRNA stability as a compensatory response to the loss of SULT2A1 activity
25482303 leptin signalling links a novel SFK/ERK1/2-mediated pathway and SK1 expression.
24587339 SK1 positivity and high expression were significantly associated with cancer and a shorter 5-year and overall survival.
22380844 study showed expression patterns of SULT1E1 and PAPSS in breast and endometrial tissues; the estrogen sulfation enzymes were comparatively higher in the tumorous tissues than adjacent normal tissues; overexpression of SULT1E1 and PAPSS1 retarded MCF-7 cells growth in vivo and in vitro by arresting cell cycles and inducing apoptosis
22242175 Unusual localisation signals of both PAPS synthase isoforms, are described.
20335228 SK1 plays an essential role in regulating in vitro paracrine angiogenesis and lymphangiogenesis.
20332099 Observational study of gene-disease association. (HuGE Navigator)
19337310 PAPSS1 maps to chromosome 4q25 and may havea role in hepatocellular carcinoma
19337310 Observational study of gene-disease association. (HuGE Navigator)
19008949 a role for PAPSS1 in the cellular sulfonation pathway requirement at a stage during or shortly after MLV provirus establishment, and subsequent influence on gene expression from the viral long terminal repeat promoter
More...

AA Sequence

MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSM      1 - 70
ALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRN     71 - 140
NARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVN    141 - 210
DCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNG    211 - 280
FMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEE    281 - 350
RCARQWGTTCKNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL    351 - 420
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAI    421 - 490
FPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPF    491 - 560
RVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSLEKA          561 - 624
//

Text Mined References (30)

PMID Year Title
25948711 2015 Upregulation of UGT2B4 Expression by 3'-Phosphoadenosine-5'-Phosphosulfate Synthase Knockdown: Implications for Coordinated Control of Bile Acid Conjugation.
25482303 2014 Leptin induces upregulation of sphingosine kinase 1 in oestrogen receptor-negative breast cancer via Src family kinase-mediated, janus kinase 2-independent pathway.
24587339 2014 Sphingosine kinase 1 and cancer: a systematic review and meta-analysis.
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
22380844 2012 Effect of estrogen sulfation by SULT1E1 and PAPSS on the development of estrogen-dependent cancers.
22242175 2012 Human PAPS synthase isoforms are dynamically regulated enzymes with access to nucleus and cytoplasm.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20335228 2010 Role of sphingosine kinase-1 in paracrine/transcellular angiogenesis and lymphangiogenesis in vitro.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
More...