Property Summary

NCBI Gene PubMed Count 30
PubMed Score 281.00
PubTator Score 18.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 2.300 2.8e-02
lung cancer 1.500 5.9e-05
malignant mesothelioma -1.700 1.9e-07
medulloblastoma, large-cell 1.100 2.9e-02
Multiple myeloma 1.177 2.1e-02
osteosarcoma 1.731 1.7e-05
ovarian cancer -2.100 6.8e-10
psoriasis 1.300 2.2e-04
Waldenstrons macroglobulinemia 1.104 1.9e-02

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSM      1 - 70
ALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRN     71 - 140
NARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVN    141 - 210
DCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNG    211 - 280
FMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEE    281 - 350
RCARQWGTTCKNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL    351 - 420
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAI    421 - 490
FPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPF    491 - 560
RVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSLEKA          561 - 624
//

Text Mined References (34)

PMID Year Title