Property Summary

NCBI Gene PubMed Count 36
PubMed Score 61.36
PubTator Score 113.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.13900426306685E-11
osteosarcoma 7933 7.65673955815551E-10
ovarian cancer 8492 1.94074893122593E-8
pediatric high grade glioma 2712 1.91991455876273E-7
glioblastoma 5572 1.28330615950123E-6
pilocytic astrocytoma 3086 1.39436344725288E-5
dermatomyositis 967 1.60812629824645E-4
atypical teratoid / rhabdoid tumor 4369 5.35393423028203E-4
colon cancer 1475 8.66318358677774E-4
invasive ductal carcinoma 2950 0.0100698133576403
subependymal giant cell astrocytoma 2287 0.020057095502606
esophageal adenocarcinoma 737 0.0209699341633829
spina bifida 1064 0.0294440173606223
primary pancreatic ductal adenocarcinoma 1271 0.0391717182350079
pancreatic cancer 2300 0.041544889053102
group 4 medulloblastoma 1875 0.0451802597068812
Disease Target Count Z-score Confidence
Benign epilepsy with centrotemporal spikes 14 3.152 1.6

Expression

  Differential Expression (16)

Synonym

Accession O43251 A4F5G8 A8K5Z5 B0QYY8 B0QYY9 Q0PRL5 Q0VH35 Q5TF71 Q6IC09 Q8TD00 Q8WYB1 Q96DZ6 Q96NL7 Q9UGW4 Q9UH33
Symbols RTA
fxh
FOX2
RBM9
Fox-2
HNRBP2
HRNBP2
dJ106I20.3

Gene

PDB

2CQ3  

Gene RIF (18)

PMID Text
25921069 CPSF2 and SYMPK, are RBFOX2 cofactors for both inclusion and exclusion of internal exons.
25524026 RBFOX proteins can facilitate the splicing of micro-exons. We also found that PTBP1 likely regulates the inclusion of micro-exons, possibly by repressing the inclusion of micro-exons that are enhanced by RBFOX proteins and other splicing factors.[RBFOX]
25087874 Results show that the conserved Rbfox2 RNA binding protein regulates 30% of the splicing transitions observed during myogenesis and is required for the specific step of myoblast fusion.
25065397 RBFOX2 SNPs showed evidence for effects across multiple reading and language traits.
24048253 MBNL1 and RBFOX2 cooperate to establish a splicing programme involved in pluripotent stem cell differentiation.
23149937 RBFOX2 drives mesenchymal tissue-specific splicing in both normal and cancer tissues.
23143756 RBFOX2 polymorphism is associated with breast cancer.
22666429 FOX-2 is involved in splicing of ataxin-2 transcripts and that this splicing event is altered by overexpression of ataxin-1
22083953 This study characterizes the mechanism by which RBFOX2 regulates protein 4.1R exon 16 splicing through the downstream intronic element UGCAUG.
21876675 functional significance of EMT-associated alternative splicing depletion of RBFOX2 in mesenchymal cells
More...

AA Sequence

MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLT      1 - 70
LYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQM     71 - 140
FGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYA    141 - 210
NGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAF    211 - 280
RGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYS    281 - 350
DGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY                                  351 - 390
//

Text Mined References (39)

PMID Year Title
25921069 2015 Global Promotion of Alternative Internal Exon Usage by mRNA 3' End Formation Factors.
25524026 2015 RBFOX and PTBP1 proteins regulate the alternative splicing of micro-exons in human brain transcripts.
25416956 2014 A proteome-scale map of the human interactome network.
25087874 2014 Rbfox2-coordinated alternative splicing of Mef2d and Rock2 controls myoblast fusion during myogenesis.
25065397 2014 Genome-wide screening for DNA variants associated with reading and language traits.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24048253 2013 MBNL1 and RBFOX2 cooperate to establish a splicing programme involved in pluripotent stem cell differentiation.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23149937 2013 RBFOX2 is an important regulator of mesenchymal tissue-specific splicing in both normal and cancer tissues.
More...