Property Summary

NCBI Gene PubMed Count 41
PubMed Score 66.16
PubTator Score 113.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 1.8e-03
Astrocytoma, Pilocytic -1.300 1.6e-05
atypical teratoid / rhabdoid tumor -1.200 2.6e-02
colon cancer -1.700 8.7e-04
dermatomyositis -1.400 1.6e-04
ependymoma -1.300 2.9e-02
esophageal adenocarcinoma -1.100 2.1e-02
glioblastoma -1.300 1.7e-07
group 4 medulloblastoma 1.200 4.5e-02
invasive ductal carcinoma -1.100 1.0e-02
osteosarcoma 3.541 2.9e-08
ovarian cancer -2.200 2.0e-11
pancreatic cancer 1.300 4.2e-02
primary pancreatic ductal adenocarcinoma 1.323 3.9e-02
spina bifida -1.665 2.9e-02
subependymal giant cell astrocytoma -1.566 4.5e-02

Gene RIF (22)

AA Sequence

MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLT      1 - 70
LYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQM     71 - 140
FGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYA    141 - 210
NGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAF    211 - 280
RGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYS    281 - 350
DGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY                                  351 - 390
//

Text Mined References (44)

PMID Year Title