Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.30
PubTator Score 10.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.8e-06
medulloblastoma, large-cell 6241 1.4e-05
malignant mesothelioma 3232 2.2e-04
psoriasis 6694 3.5e-04
cutaneous lupus erythematosus 1057 7.0e-03
Disease Target Count Z-score Confidence
Clubfoot 39 3.897 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.800 7.0e-03
malignant mesothelioma 1.100 2.2e-04
medulloblastoma, large-cell 1.200 1.4e-05
osteosarcoma 2.428 1.8e-06
psoriasis -1.200 3.5e-04

Gene RIF (3)

AA Sequence

MFNSVNLGNFCSPSRKERGADFGERGSCASNLYLPSCTYYMPEFSTVSSFLPQAPSRQISYPYSAQVPPV      1 - 70
REVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSS     71 - 140
VNKNSVLPQAFDRFFDNAYCGGGDPPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSS    141 - 210
SGSAHSVAKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWF    211 - 280
QNRRMKEKKLSRDRLQYFSGNPLL                                                  281 - 304
//

Text Mined References (19)

PMID Year Title