Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
Funding $348,691.33
PubMed Score 66.67
PubTator Score 26.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.260 0.000

Gene RIF (8)

PMID Text
20685009 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20584552 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20452607 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18460403 These results suggest a heterogeneous immunophenotype and genotype for c-myc/Ig DLBCL, with CD10(-)/BCL6(+)/MUM1(-) cases the most frequent.
17051526 ZAP-70 reactivity using a T-cell marker as a control allows to identify the majority of patients with an unmutated Ig VH genotype.
12049641 expression in cell membrane is not sufficient for amino acid transport (SOLUTE CARRIER SLC7A4)
11665818 analysis of the genomic organization
10700465 The CDR1, FR2, and CDR3 regions of the VH3 family gene significantly contribute to its binding to HIV-1 gp120

AA Sequence

MARGLPTIASLARLCQKLNRLKPLEDSTMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTGAVAKEVAGPA      1 - 70
VLLSFGVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGELWAFLIGWNVLLEYIIGGAAVARAWSGY     71 - 140
LDSMFSHSIRNFTETHVGSWQVPLLGHYPDFLAAGIILLASAFVSCGARVSSWLNHTFSAISLLVILFIV    141 - 210
ILGFILAQPHNWSADEGGFAPFGFSGVMAGTASCFYAFVGFDVIAASSEEAQNPRRSVPLAIAISLAIAA    211 - 280
GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMNTVLLSLLFSLPRIVYAMAAD    281 - 350
GLFFQVFAHVHPRTQVPVAGTLAFGLLTAFLALLLDLESLVQFLSLGTLLAYTFVATSIIVLRFQKSSPP    351 - 420
SSPGPASPGPLTKQQSSFSDHLQLVGTVHASVPEPGELKPALRPYLGFLDGYSPGAVVTWALGVMLASAI    421 - 490
TIGCVLVFGNSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYREDLFQIPMVPLIPALSIVLNICLM    491 - 560
LKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQD    561 - 630
PGHME                                                                     631 - 635
//

Text Mined References (12)

PMID Year Title
20685009 2012 Association of serotonin and dopamine gene pathways with behavioral subphenotypes in dementia.
20584552 2010 The role of clinical variables, neuropsychological performance and SLC6A4 and COMT gene polymorphisms on the prediction of early response to fluoxetine in major depressive disorder.
20452607 2010 Influence of serotonin transporter gene polymorphisms on clozapine response in Brazilian schizophrenics.
18460403 2008 Characterization of de novo diffuse large B-cell lymphoma with a translocation of c-myc and immunoglobulin genes.
17051526 2007 Comparative analysis of ZAP-70 expression and Ig VH mutational status in B-cell chronic lymphocytic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12049641 2002 Expression of solute carrier 7A4 (SLC7A4) in the plasma membrane is not sufficient to mediate amino acid transport activity.
11665818 2001 Analysis of the genomic organization of the human cationic amino acid transporters CAT-1, CAT-2 and CAT-4.
More...