Property Summary

NCBI Gene PubMed Count 12
PubMed Score 73.29
PubTator Score 26.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.4e-05
Disease Target Count Z-score Confidence
Chromophobe adenoma 2 3.55 1.8
farmer's lung 2 3.31 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.260 2.4e-05

Gene RIF (8)

AA Sequence

MARGLPTIASLARLCQKLNRLKPLEDSTMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTGAVAKEVAGPA      1 - 70
VLLSFGVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGELWAFLIGWNVLLEYIIGGAAVARAWSGY     71 - 140
LDSMFSHSIRNFTETHVGSWQVPLLGHYPDFLAAGIILLASAFVSCGARVSSWLNHTFSAISLLVILFIV    141 - 210
ILGFILAQPHNWSADEGGFAPFGFSGVMAGTASCFYAFVGFDVIAASSEEAQNPRRSVPLAIAISLAIAA    211 - 280
GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMNTVLLSLLFSLPRIVYAMAAD    281 - 350
GLFFQVFAHVHPRTQVPVAGTLAFGLLTAFLALLLDLESLVQFLSLGTLLAYTFVATSIIVLRFQKSSPP    351 - 420
SSPGPASPGPLTKQQSSFSDHLQLVGTVHASVPEPGELKPALRPYLGFLDGYSPGAVVTWALGVMLASAI    421 - 490
TIGCVLVFGNSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYREDLFQIPMVPLIPALSIVLNICLM    491 - 560
LKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQD    561 - 630
PGHME                                                                     631 - 635
//

Text Mined References (12)

PMID Year Title