Property Summary

NCBI Gene PubMed Count 49
Grant Count 2
Funding $451,245.92
PubMed Score 15.39
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 2.000 0.003
lung adenocarcinoma 1.042 0.000
dermatomyositis -1.200 0.004

Synonym

Accession O43242 B3KMW9 B4DT72 Q96EI2 Q9BQA4
Symbols S3
P58
RPN3
TSTA2

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

5GJQ   5GJR   5L4K  

 GO Function (1)

 GWAS Trait (1)

Gene RIF (33)

PMID Text
25515861 A strong association between genetic variant rs2305482 in PSMD3 on chromosome 17 and IFN-induced neutropenia.
23303871 Our study suggests that PSMD3 variants are associated with insulin resistance in populations of different ancestries and that these relationships may also be modified by dietary factors.
22788528 HNF1A gene was associated with C-reactive protein, and the region including PSMD3 and CSF3 genes was associated with white blood cell count.
22037903 Study identified significantly white blood cell count (WBC) level associated SNPs of three separate genes GSDMA, MED24, and PSMD3 in European continent (EA) subjects.
20172861 The significant contribution of PSMD3-CSF3 and PLCB4 loci to the regulation of neutrophil count, is demonstrated.
20172861 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
14614829 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14564014 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14557625 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14550573 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
More...

AA Sequence

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTV      1 - 70
TLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMD     71 - 140
TEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKC    141 - 210
YYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQA    211 - 280
NNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQ    281 - 350
PSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA    351 - 420
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMS    421 - 490
VKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP                              491 - 534
//

Text Mined References (55)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25515861 2015 Genome-wide association study identifies a PSMD3 variant associated with neutropenia in interferon-based therapy for chronic hepatitis C.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23303871 2013 Genetic variants at PSMD3 interact with dietary fat and carbohydrate to modulate insulin resistance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22788528 2013 Genetic associations with C-reactive protein level and white blood cell count in the KARE study.
22037903 2012 Genetic variants associated with the white blood cell count in 13,923 subjects in the eMERGE Network.
More...