Property Summary

NCBI Gene PubMed Count 52
PubMed Score 15.91
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 2.5e-08
breast carcinoma 1638 2.6e-03
dermatomyositis 966 4.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 2.000 2.6e-03
dermatomyositis -1.200 4.2e-03
lung adenocarcinoma 1.042 2.5e-08

Synonym

Accession O43242 B3KMW9 B4DT72 Q96EI2 Q9BQA4
Symbols S3
P58
RPN3
TSTA2

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5L4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GO Function (1)

Protein-protein Interaction (10)

Gene RIF (32)

AA Sequence

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTV      1 - 70
TLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMD     71 - 140
TEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKC    141 - 210
YYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQA    211 - 280
NNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQ    281 - 350
PSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA    351 - 420
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMS    421 - 490
VKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP                              491 - 534
//

Text Mined References (62)

PMID Year Title