Property Summary

NCBI Gene PubMed Count 61
PubMed Score 58.31
PubTator Score 71.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 5.3e-03
Breast cancer -1.800 2.5e-05
colon cancer 3.100 1.3e-02
cutaneous lupus erythematosus 1.500 1.7e-02
esophageal adenocarcinoma -2.200 4.8e-02
intraductal papillary-mucinous neoplasm ... 2.800 8.4e-05
lung adenocarcinoma -2.200 1.1e-05
pancreatic cancer 3.300 1.9e-06
psoriasis 2.000 4.1e-10
ulcerative colitis 4.400 1.7e-04

Gene RIF (49)

AA Sequence

MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFH      1 - 70
CAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLML     71 - 140
LKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVT    141 - 210
NNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN        211 - 276
//

Text Mined References (61)

PMID Year Title