Property Summary

NCBI Gene PubMed Count 57
Grant Count 5
R01 Count 5
Funding $1,983,551
PubMed Score 53.74
PubTator Score 71.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (45)

PMID Text
26616394 KLK10 may function as a tumour suppressor by repressing proliferation, enhancing apoptosis and decreasing glucose metabolism in PC3 cells.
26172508 Data indicate that elevated expression of microRNA-375 in head and neck squamous cell carcinoma (HNSCC) cells significantly reduces kallikrein 6 (KLK6), kallikrein 10 (KLK10), and matrix metalloproteinase 9 (MMP9) messenger RNA expression.
25649006 KLK6 and KLK10 may be useful markers and potential therapeutic targets in gastroesophageal junction tumors
25553760 treated and untreated prolactin-producing pituitary adenomas and carcinomas as well as TSH-producing pituitary adenomas and carcinomas were conclusively immunopositive for KLK10
25517869 Immunoexpression of KLK10 in the ACTH-secreting tumors as well as in the Crooke cell tumors was significantly increased when compared with the nonfunctioning tumors and in the corticotrophs of non-tumorous pituitaries.
25153389 This study assessed the prognostic utility of human tissue kallikrein-like peptidases 6 and 10 (KLK6 and KLK10) and correlated their expression with histopathological and clinical parameters in gastric cancer.
24409072 KLK10 expression is an independent biomarker of unfavorable prognosis in patients with gastric cancer.
23499583 Patients with high KLK10 expression had a shorter disease-free and overall survival rates.
23413953 is the first correlation of oral squamous cell carcinoma with KLK10 rs3745535G>T polymorphisms
23268413 Enhancing KLK10 gene expression can decrease the proliferation and invasiveness of human tongue cancer cells in vitro.
More...

AA Sequence

MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFH      1 - 70
CAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLML     71 - 140
LKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVT    141 - 210
NNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN        211 - 276
//

Text Mined References (57)

PMID Year Title
26616394 2015 NES1/KLK10 gene represses proliferation, enhances apoptosis and down-regulates glucose metabolism of PC3 prostate cancer cells.
26172508 2015 MicroRNA-375 Suppresses Extracellular Matrix Degradation and Invadopodial Activity in Head and Neck Squamous Cell Carcinoma.
25649006 2015 Evaluation of human tissue kallikrein-related peptidases 6 and 10 expression in early gastroesophageal adenocarcinoma.
25553760 Human kallikrein 10 in surgically removed human pituitary adenomas.
25517869 2015 Human kallikrein 10 expression in surgically removed human pituitary corticotroph adenomas: an immunohistochemical study.
25153389 2014 Prognostic significance of human tissue kallikrein-related peptidases 6 and 10 in gastric cancer.
24409072 2013 Overexpression of kallikrein gene 10 is a biomarker for predicting poor prognosis in gastric cancer.
23499583 2013 Clinical significance of kallikrein-related peptidase (KLK10) mRNA expression in colorectal cancer.
23413953 2013 Polymorphisms in Kallikrein7 and 10 genes and oral cancer risks in Taiwan betel quid chewers and smokers.
23268413 2012 [Enhancement of kallikrein-related peptidase 10 expression attenuates proliferation and invasiveness of human tongue cancer cells in vitro].
More...