Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.87
PubTator Score 6.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.167 4.8e-05
group 3 medulloblastoma -1.100 2.9e-02
intraductal papillary-mucinous adenoma (... 1.100 3.7e-02
juvenile dermatomyositis 1.022 4.6e-09
medulloblastoma, large-cell -1.600 4.7e-04
osteosarcoma 2.800 1.5e-05
ovarian cancer -1.500 2.3e-10
pancreatic cancer 1.300 2.0e-02
pancreatic ductal adenocarcinoma liver m... 1.818 1.0e-02

Gene RIF (8)

AA Sequence

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTL      1 - 70
MTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMS     71 - 140
RPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENV    141 - 210
ALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNL    211 - 280
DLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH    281 - 350
DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIK    351 - 420
NNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTEN    421 - 490
EA                                                                        491 - 492
//

Text Mined References (27)

PMID Year Title