Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.70
PubTator Score 6.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43237 A8K6V1 B4DZP4 Q8TAT3
Symbols LIC2
DNCLI2

Gene

Gene RIF (5)

PMID Text
25818806 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
25422374 although dynein lacking light intermediate chains (LICs) drives microtubule gliding at normal rates, the LICs are required for the formation and maintenance of a bipolar spindle.
25231297 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
21169557 using a variety of complementary approaches, our results indicate a novel specific role for the LICs in dynein recruitment to components of the late endocytic pathway.
20214888 FIP3 was identified as the first membrane-associated interacting-partner for DLIC-2.

AA Sequence

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTL      1 - 70
MTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMS     71 - 140
RPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENV    141 - 210
ALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNL    211 - 280
DLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH    281 - 350
DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIK    351 - 420
NNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTEN    421 - 490
EA                                                                        491 - 492
//

Text Mined References (24)

PMID Year Title
25422374 2014 Dynein light intermediate chains maintain spindle bipolarity by functioning in centriole cohesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21169557 2011 Recruitment of dynein to late endosomes and lysosomes through light intermediate chains.
20214888 2010 Rab11-FIP3 binds dynein light intermediate chain 2 and its overexpression fragments the Golgi complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...