Property Summary

NCBI Gene PubMed Count 46
PubMed Score 232.65
PubTator Score 603.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -2.629 3.5e-04
adult high grade glioma -3.200 1.3e-04
astrocytic glioma -2.500 2.2e-02
Astrocytoma, Pilocytic -1.700 2.5e-04
atypical teratoid / rhabdoid tumor -4.200 8.8e-08
ependymoma -2.500 2.4e-06
glioblastoma -2.400 3.8e-06
group 3 medulloblastoma -2.000 1.6e-02
interstitial cystitis 1.400 3.5e-04
intraductal papillary-mucinous adenoma (... -1.100 6.0e-04
intraductal papillary-mucinous carcinoma... -1.200 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.0e-03
invasive ductal carcinoma -1.500 1.3e-03
lung adenocarcinoma -1.055 2.6e-08
lung cancer -2.000 2.5e-04
medulloblastoma, large-cell -3.100 1.8e-03
nephrosclerosis 1.207 4.2e-05
non-small cell lung cancer -1.601 1.7e-20
oligodendroglioma -1.600 4.4e-07
osteosarcoma -1.210 4.5e-04
Pick disease -1.500 9.7e-05
primitive neuroectodermal tumor -2.500 6.0e-03
progressive supranuclear palsy -1.200 2.0e-02
psoriasis -1.500 2.0e-04
subependymal giant cell astrocytoma -4.480 3.4e-03

Gene RIF (28)

AA Sequence

MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPD      1 - 70
LYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVK     71 - 140
KGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTP    141 - 210
GFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQ    211 - 280
RVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSN    281 - 350
TVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVV    351 - 420
KERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY                421 - 478
//

Text Mined References (49)

PMID Year Title