Property Summary

NCBI Gene PubMed Count 45
Grant Count 184
R01 Count 66
Funding $118,268,689.67
PubMed Score 216.35
PubTator Score 603.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43236 B2RD42 B3KSX9 B4DXC6 B4DXV5 Q6IAP3 Q9H315 Q9UM58
Symbols H5
ARTS
MART
SEP4
CE5B3
PNUTL2
hucep-7
BRADEION
hCDCREL-2

Gene

Gene RIF (28)

PMID Text
25527525 The data suggest that Sept4_i1 induces hepatic stellate cell apoptosis by inhibiting Akt and Bcl-2 expression and up-regulating PPAR-gamma expression.
23479728 Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.
23180367 results suggest that Septin4 may be involved in the process of activation of hepatic stellate cells by lipopolysaccharide stimulation.
22503047 Bradeion/SEPT4 transcript levels are significantly increased in patients with transitional cell bladder cancer.We hypothesize that Bradeion is directly involved in bladder cancer pathogenesis with the highest expression at early cancer stages.
21952823 these data suggests a tumor suppressor role of SEPT4_i1 in HCC through regulating hepatocellular carcinoma cell apoptosis.
21938432 SEPT4 is a Notch target gene.
21898991 The expression of SEPT4 is significantly decreased in the ejaculated sperm of idiopathic asthenozoospermia patients.
21824006 ARTS is localized at mitochondria and promotes programmed cell death (apoptosis).
20877624 Observational study of gene-disease association. (HuGE Navigator)
19221096 structural defects in sperm are not caused by abnormal transcription or point mutations of the TAT1 and SEPT4 genes; however, although both proteins are expressed, they are not properly localized at sperm annulus
More...

AA Sequence

MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPD      1 - 70
LYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVK     71 - 140
KGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTP    141 - 210
GFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQ    211 - 280
RVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSN    281 - 350
TVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVV    351 - 420
KERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY                421 - 478
//

Text Mined References (48)

PMID Year Title
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25527525 2015 Septin4_i1 regulates apoptosis in hepatic stellate cells through peroxisome proliferator-activated receptor-?/Akt/B-cell lymphoma 2 pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23479728 2013 Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.
23180367 2013 Expression of Septin4 in human hepatic stellate cells LX-2 stimulated by LPS.
22503047 2012 Bradeion (SEPT4) as a urinary marker of transitional cell bladder cancer: a real-time polymerase chain reaction study of gene expression.
21952823 2012 Involvement of SEPT4_i1 in hepatocellular carcinoma: SEPT4_i1 regulates susceptibility to apoptosis in hepatocellular carcinoma cells.
21938432 2012 SEPT4 is regulated by the Notch signaling pathway.
21898991 2011 [Expression of SEPT4 protein in the ejaculated sperm of idiopathic asthenozoospermic men].
More...