Property Summary

NCBI Gene PubMed Count 41
Grant Count 59
R01 Count 46
Funding $4,224,642.15
PubMed Score 0.00
PubTator Score 37.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lupus Erythematosus, Systemic 73

Expression

Synonym

Accession O43196 B0V033 B0V034 O60586 Q5BLU9 Q5SSR1 Q8IW44 Q9BQC7 hMSH5
Symbols G7
NG23
MUTSH5

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (28)

PMID Text
26055704 our data point to the existence of a functional interplay between hMSH5 and FANCJ in double-strand break repair induced by replication stress.
24023853 the roles of hMSH5 variants in the processes of DNA damage response and repair
22917773 Authors show that MSH5 (MutSHomolog 5) is localized into the mitochondria of germ and somatic cells.
22401567 Study has suggested a role for hMSH5 in the processing of cisplatin-induced DSBs, and silencing of hMSH5 may provide a new means to improve the therapeutic efficacy of cisplatin.
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20542071 The presence of the MSH5 85F allele marks the subgroup of DRB1*0102 haplotypes carrying susceptibility for selective IgA deficiency. MSH5 polymorphisms per se are not predisposing factors.
20542071 Observational study of gene-disease association. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
20185565 hMSH5 possesses a CRM1-dependent nuclear export signal and a nuclear localization signal that participates to its nuclear targeting.
More...

AA Sequence

MASLGANPRRTPQGPRPGAASSGFPSPAPVPGPREAEEEEVEEEEELAEIHLCVLWNSGYLGIAYYDTSD      1 - 70
STIHFMPDAPDHESLKLLQRVLDEINPQSVVTSAKQDENMTRFLGKLASQEHREPKRPEIIFLPSVDFGL     71 - 140
EISKQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILG    141 - 210
FKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHD    211 - 280
LGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDAC    281 - 350
RSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEV    351 - 420
ARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALL    421 - 490
GDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQN    491 - 560
GRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDA    561 - 630
IFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTC    631 - 700
PHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVAR    701 - 770
GKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL          771 - 834
//

Text Mined References (42)

PMID Year Title
26055704 2015 hMSH5 Facilitates the Repair of Camptothecin-induced Double-strand Breaks through an Interaction with FANCJ.
24837172 2015 Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.
24023853 2013 MutS homologue hMSH5: recombinational DSB repair and non-synonymous polymorphic variants.
22917773 2012 The human MSH5 (MutSHomolog 5) protein localizes to mitochondria and protects the mitochondrial genome from oxidative damage.
22401567 2012 MutS homologue hMSH5: role in cisplatin-induced DNA damage response.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20542071 2010 MSH5 is not a genetic predisposing factor for immunoglobulin A deficiency but marks the HLA-DRB1*0102 subgroup carrying susceptibility.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20185565 2010 hMSH5 is a nucleocytoplasmic shuttling protein whose stability depends on its subcellular localization.
More...