Property Summary

NCBI Gene PubMed Count 36
PubMed Score 59.08
PubTator Score 42.38

Knowledge Summary

Patent (8,967)


  Disease Sources (5)

Disease Target Count
Hypertensive disease 193
Disease Target Count P-value
lung carcinoma 2844 7.26072180981547E-11
malignant mesothelioma 3163 3.03288036176885E-7
cystic fibrosis 1670 3.43031584692106E-7
osteosarcoma 7933 2.16547509604137E-6
posterior fossa group B ependymoma 1530 1.02980272214797E-5
ovarian cancer 8492 6.91675436763295E-4
ulcerative colitis 2087 8.71245422964304E-4
interstitial cystitis 2299 0.00129608321806824
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00272673282071941
ductal carcinoma in situ 1745 0.00443142798628306
cutaneous lupus erythematosus 1056 0.0108677125894289
intraductal papillary-mucinous adenoma (IPMA) 2956 0.024941365895867
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
Plummer's disease 7 3.077 1.5



Accession O43194 B2RC12 B6V9G4 Q08AS2 Q53R01


PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

 GWAS Trait (1)

Gene RIF (19)

25490458 Chronic administration of many antidepressants induces GPR39 up-regulation, which suggests that the Zn(2+)-sensing receptor may be considered as a new target for drug development in the field of depression.
24967969 ZnR/GPR39-dependent expression of tight junctional proteins, thereby leading to formation of a sealed intestinal epithelial barrier.
24512471 Taken together, our results provided a novel regulatory mechanism for GPR39-1b in NTRS1 signaling.
24333148 Data suggests alterations (down-regulation) of the GPR39 receptor and involvement of CREB-BDNF pathway, possibly triggered by GPR39, as a new pathomechanism of depression
24264723 Zn(2+) -dependent activation of ZnR/GPR39 also enhances the expression of the Ca(2+) -binding protein S100A4 that is linked to invasion of prostate cancer cells.
23485550 GPR39 was present in thyroid autoimmune disease, non-toxic nodular goiter and toxic nodular goiter at band p51(kDa).
22879599 ZnR/GPR39 is tuned to sense physiologically relevant changes in extracellular pH that regulate ZnR-dependent signaling and ion transport activity
22545109 GPR39 activation increased the expression of the anti-apoptotic protein clusterin in butyrate-treated cells. GPR39 mediates Zn2+-dependent cell growth.
21352519 GPR39 plays an important tumorigenic role in the development and progression of esophageal squamous cell carcinoma.
20522546 extracellular Zn(2+), either applied or released following injury, activates ZnR/GPR39 to promote signaling leading to epithelial repair

AA Sequence

SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV                                         421 - 453

Text Mined References (39)

PMID Year Title
26716511 2016 The role of the obestatin/GPR39 system in human gastric adenocarcinomas.
26211463 2016 ?-Arrestin scaffolds and signaling elements essential for the obestatin/GPR39 system that determine the myogenic program in human myoblast cells.
25933983 2015 Zinc, future mono/adjunctive therapy for depression: Mechanisms of antidepressant action.
25490458 2015 GPR39 Zn(2+)-sensing receptor: a new target in antidepressant development?
24967969 2014 The zinc sensing receptor, ZnR/GPR39, controls proliferation and differentiation of colonocytes and thereby tight junction formation in the colon.
24869658 2014 Protein kinase inhibitor ? enhances the constitutive activity of G-protein-coupled zinc receptor GPR39.
24732935 2014 Obestatin: is it really doing something?
24633354 2014 Target identification for a Hedgehog pathway inhibitor reveals the receptor GPR39.
24512471 2014 GPR39-1b, the 5-transmembrane isoform of GPR39 interacts with neurotensin receptor NTSR1 and modifies its function.
24333148 2014 The involvement of the GPR39-Zn(2+)-sensing receptor in the pathophysiology of depression. Studies in rodent models and suicide victims.