Property Summary

Ligand Count 19
NCBI Gene PubMed Count 38
PubMed Score 66.53
PubTator Score 42.38

Knowledge Summary

Patent (8,967)


  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 1.1e-02
cystic fibrosis 1.102 1.1e-04
ductal carcinoma in situ 2.000 4.4e-03
ependymoma 1.200 6.7e-03
interstitial cystitis -2.000 1.3e-03
intraductal papillary-mucinous adenoma (... 1.300 2.5e-02
intraductal papillary-mucinous neoplasm ... 2.100 2.7e-03
lung carcinoma 1.100 7.3e-11
malignant mesothelioma -2.800 3.0e-07
osteosarcoma -1.440 2.2e-06
ovarian cancer 1.900 6.9e-04
ulcerative colitis -1.100 1.6e-04

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV                                         421 - 453

Text Mined References (41)

PMID Year Title