Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
Funding $746,922.14
PubMed Score 125.50
PubTator Score 38.67

Knowledge Summary

Patent (7,988)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 0.000

Gene RIF (8)

PMID Text
23142315 data support important roles of new regions in the TM domains of the motilin receptor for erythromycin action, suggesting differential mechanisms of actions by peptidyl and non-peptidyl ligands
22465164 The data suggested that in species expressing both motilin-MR and ghrelin-GHSR, there is a compensatory relationship in vivo.
20424473 Observational study of gene-disease association. (HuGE Navigator)
18420306 Desensitization and internalization of MLNR is independent of the C-terminal tail.
18183601 The motilin receptor is expressed in human colonic and ileal smooth muscle. Further, motilin receptor expression was also shown in the mucosa.
18032475 action by different chemical classes of agonists that are known to interact with distinct regions of the motilin receptor likely yield a common activation state of the cytosolic face of this receptor
16531413 motilin receptor extracellular domains have roles in peptide and non-peptidyl agonist binding and activity
12054506 The motilin pharmacophore in CHO cells expressing the human motilin receptor

AA Sequence

MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTVMLIGRYRDMR      1 - 70
TTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEGCTYATLLHMTALSVERYLAI     71 - 140
CRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVEQDPGISVVPGLNGTARIASSPLASSPPLWL    141 - 210
SRAPPPSPPSGPETAEAAALFSRECRPSPAQLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSSRRP    211 - 280
LRGPAASGRERGHRQTVRVLLVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASI    281 - 350
NPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGDTVGYTETSANVKTMG            351 - 412
//

Text Mined References (17)

PMID Year Title
23142315 2013 Critical residues in the transmembrane helical bundle domains of the human motilin receptor for erythromycin binding and activity.
22465164 2012 A relationship between motilin and growth hormone secretagogue receptors.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
18420306 2008 Desensitization and internalization of the human motilin receptor is independent of the C-terminal tail.
18183601 2008 Motilin receptor expression in smooth muscle, myenteric plexus, and mucosa of human inflamed and noninflamed intestine.
18032475 2008 Mutational analysis of predicted intracellular loop domains of human motilin receptor.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16531413 2006 Differential contributions of motilin receptor extracellular domains for peptide and non-peptidyl agonist binding and activity.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12606621 2003 Interaction of the growth hormone-releasing peptides ghrelin and growth hormone-releasing peptide-6 with the motilin receptor in the rabbit gastric antrum.
More...