Property Summary

NCBI Gene PubMed Count 37
Grant Count 15
R01 Count 10
Funding $750,640.47
PubMed Score 31.11
PubTator Score 23.44

Knowledge Summary

Patent (7,154)

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.500 0.032
oligodendroglioma -1.400 0.024
osteosarcoma -1.974 0.000
cystic fibrosis 1.836 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.100 0.000
tuberculosis -3.300 0.000
intraductal papillary-mucinous neoplasm ... 2.600 0.005
active ulcerative colitis 2.045 0.036
pancreatic cancer 1.300 0.000
psoriasis 2.000 0.000
nasopharyngeal carcinoma -1.200 0.000

Gene RIF (25)

PMID Text
26250868 IRAK2 L392V showed intact binding to, but impaired ubiquitination of, tumor necrosis factor receptor-associated factor 6, a vital step in signal transduction
25063738 Human miR-373 is silenced by histone modification in lung cancer cells and is a negative regulator of the mesenchymal phenotype through downstream IRAK2 and LAMP1 target genes.
24973222 This for the first time implicates human IRAK2 in a human disease and highlights the R214G IRAK2 variant as a potential novel and broadly applicable biomarker for disease or as a therapeutic intervention point.
24662294 Results suggest that D431E-IRAK2 (interleukin-1 receptor-associated kinase-2) increases NF-kappaB activation by promoting TRAF6 ubiquitination by enhancing TNF Receptor-Associated Factor 6 (TRAF6)-IRAK2 interaction.
24162774 HIV-1 gp120 upregulates the expression of interleukin-1 receptor-associated kinase 2 (IRAK2) in human B cells
23724040 These findings demonstrate an unexpected linkage of the innate immunity machinery to unfolded protein response signaling, revealing IRAK2 as a novel amplifier of the IRE1 pathway.
21606490 Human interleukin-1 receptor-associated kinase-2 is essential for Toll-like receptor-mediated transcriptional and post-transcriptional regulation of tumor necrosis factor alpha.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20937840 analysis of differential regulation of interleukin-1 receptor-associated kinase-1 (IRAK-1) and IRAK-2 by microRNA-146a and NF-kappaB in stressed human astroglial cells and in Alzheimer disease
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQAT      1 - 70
VQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPG     71 - 140
PGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF    141 - 210
NQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQ    211 - 280
FHSFIYPYMANGSLQDRLQGQGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPK    281 - 350
LAHPMAHLCPVNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS    351 - 420
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACLCLRRRNTSLQ    421 - 490
EVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDASSSMSVAPWAGAATPLLPTEN    491 - 560
GEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFGP         561 - 625
//

Text Mined References (41)

PMID Year Title
26250868 2015 A frequent hypofunctional IRAK2 variant is associated with reduced spontaneous hepatitis C virus clearance.
25063738 2014 Epigenetic silencing of microRNA-373 to epithelial-mesenchymal transition in non-small cell lung cancer through IRAK2 and LAMP1 axes.
24973222 2014 A coding IRAK2 protein variant compromises Toll-like receptor (TLR) signaling and is associated with colorectal cancer survival.
24662294 2014 Interleukin-1 receptor-associated kinase-2 genetic variant rs708035 increases NF-?B activity through promoting TRAF6 ubiquitination.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23724040 2013 Interleukin-1 receptor-associated kinase-2 (IRAK2) is a critical mediator of endoplasmic reticulum (ER) stress signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21606490 2011 Human interleukin-1 receptor-associated kinase-2 is essential for Toll-like receptor-mediated transcriptional and post-transcriptional regulation of tumor necrosis factor alpha.
More...