Property Summary

NCBI Gene PubMed Count 37
PubMed Score 34.86
PubTator Score 23.44

Knowledge Summary

Patent (7,154)

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis 2.045 3.6e-02
cystic fibrosis 1.836 4.4e-05
ependymoma -1.500 3.2e-02
intraductal papillary-mucinous neoplasm ... 2.600 4.6e-03
medulloblastoma -1.400 5.5e-06
medulloblastoma, large-cell -1.700 4.0e-05
nasopharyngeal carcinoma -1.200 6.6e-05
oligodendroglioma -1.400 2.4e-02
osteosarcoma -1.974 9.3e-06
pancreatic cancer 1.300 8.3e-05
primitive neuroectodermal tumor -1.100 4.7e-04
psoriasis 1.400 5.5e-34
tuberculosis -3.300 9.3e-07

Protein-protein Interaction (4)

Gene RIF (25)

AA Sequence

MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQAT      1 - 70
VQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPG     71 - 140
PGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF    141 - 210
NQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQ    211 - 280
FHSFIYPYMANGSLQDRLQGQGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPK    281 - 350
LAHPMAHLCPVNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS    351 - 420
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACLCLRRRNTSLQ    421 - 490
EVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDASSSMSVAPWAGAATPLLPTEN    491 - 560
GEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFGP         561 - 625
//

Text Mined References (41)

PMID Year Title