Property Summary

NCBI Gene PubMed Count 172
PubMed Score 200.76
PubTator Score 226.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 4.77505703575869E-31
non-small cell lung cancer 2798 5.55088396408605E-27
lung adenocarcinoma 2714 5.82240547117683E-13
malignant mesothelioma 3163 1.05548255351194E-8
posterior fossa group A ependymoma 1511 2.67918151313016E-8
breast carcinoma 1614 1.37374282570903E-7
glioblastoma 5572 2.44006522950034E-7
pilocytic astrocytoma 3086 9.05036469678613E-7
pediatric high grade glioma 2712 2.0096789473205E-4
medulloblastoma 1524 3.571145829248E-4
interstitial cystitis 2299 3.82595133721093E-4
atypical teratoid / rhabdoid tumor 4369 9.1984909128376E-4
primary Sjogren syndrome 789 9.59930096778236E-4
osteosarcoma 7933 0.00119570242014001
ovarian cancer 8492 0.00352666882011773
medulloblastoma, large-cell 6234 0.0048637973132587
pancreatic cancer 2300 0.00634480825192795
lung cancer 4473 0.00701894861884471
ductal carcinoma in situ 1745 0.0146623432147292
primary pancreatic ductal adenocarcinoma 1271 0.0156566572168954
X-linked cerebral adrenoleukodystrophy 115 0.0168264231725788
cutaneous lupus erythematosus 1056 0.0171057217576654
Breast cancer 3099 0.0215510499526643
ulcerative colitis 2087 0.0250628044048999
Endometriosis 535 0.035221205367495
adrenocortical carcinoma 1427 0.0374677694746178
interstitial lung disease 292 0.0378149367571532
primitive neuroectodermal tumor 3031 0.0441723465389587
invasive ductal carcinoma 2950 0.0463776796316194
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession O43184 O60470 Q5JRP0 Q5JRP1 Q6P9E3 Q6UWB0 ADAM 12
Symbols MCMP
MLTN
CAR10
MLTNA
MCMPMltna
ADAM12-OT1

Gene

  Ortholog (11)

 CSPA Cell Line (2)

Gene RIF (118)

PMID Text
26722530 The level of ADAM12 was upregulated in tumor tissues of breast cancer compared to that of adjacent normal tissues. patients with higher level of ADAM12 exhibited shorter survival time compared to that of low level of ADAM12
26697810 The first trimester maternal ADAM12-s levels were statistically significantly higher in the entire ART group, IVF and ICSI groups, and normal cycle-frozen embryo transfer group when compared with those in the controls.
26553447 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma
26503019 the present findings support the conclusion that the E2F1 transcription factor regulates the expression of ADAM12 by binding differential cis-acting elements.
26407179 ADAM12L is associated with epithelial to mesenchymal transition (EMT) and contributes to TGF-beta-dependent EMT.
26051455 Data suggest that low serum levels of ADAM12/hCG may be biomarkers in diagnosis of continued incomplete spontaneous abortion; here, ADAM12/hCG indicate success/failure of single dose of misoprostol/oxytocic in treatment of early pregnancy failure.
25926422 ADAM12 expression is associated with an aggressive molecular subtype of high-grade serous ovarian carcinoma.High serum protein levels of ADAM12 are associated with poor survival in patients with high-grade serous ovarian carcinoma.
25909890 The siRNA-directed loss of ADAM12 impedes spontaneous fusion of primary cytotrophoblasts, whereas overexpression of the secreted variant, ADAM12S, potentiates cell fusion in the Bewo trophoblast cell line.
25886595 The ADAM12-L 3'UTR is a direct target of miR-29 and miR-200 family members.
25667922 Studied the potential role of four SNPs of the ADAM12 gene in susceptibility to knee osteoarthritis and its progression in Chinese Han population.
More...

AA Sequence

MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNI      1 - 70
RLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSG     71 - 140
LRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETL    141 - 210
KATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPF    211 - 280
TSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAH    281 - 350
ELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRE    351 - 420
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCD    421 - 490
LPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYG    491 - 560
NCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPG    561 - 630
LVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGP    631 - 700
IRQADNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGH    701 - 770
LGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKP    771 - 840
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVPRSTHTAYIK     841 - 909
//

Text Mined References (176)

PMID Year Title
26722530 2015 ADAM12 expression predicts clinical outcome in estrogen receptor-positive breast cancer.
26697810 2016 First-trimester maternal serum ADAM12-s and PAPP-A levels are altered in pregnancies conceived after assisted reproduction techniques (ART).
26553447 2016 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma.
26503019 2015 Expression of ADAM12 is regulated by E2F1 in small cell lung cancer.
26407179 2015 The Disintegrin and Metalloprotease ADAM12 Is Associated with TGF-?-Induced Epithelial to Mesenchymal Transition.
26051455 2015 Serum biomarkers may help predict successful misoprostol management of early pregnancy failure.
25926422 2015 ADAM12 is a prognostic factor associated with an aggressive molecular subtype of high-grade serous ovarian carcinoma.
25909890 2015 ADAM12-directed ectodomain shedding of E-cadherin potentiates trophoblast fusion.
25886595 2015 ADAM12-L is a direct target of the miR-29 and miR-200 families in breast cancer.
25667922 2015 Analysis of single nucleotide polymorphisms within ADAM12 and risk of knee osteoarthritis in a Chinese Han population.
More...