Property Summary

NCBI Gene PubMed Count 172
Grant Count 44
R01 Count 25
Funding $7,519,405.92
PubMed Score 200.76
PubTator Score 226.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (118)

PMID Text
26722530 The level of ADAM12 was upregulated in tumor tissues of breast cancer compared to that of adjacent normal tissues. patients with higher level of ADAM12 exhibited shorter survival time compared to that of low level of ADAM12
26697810 The first trimester maternal ADAM12-s levels were statistically significantly higher in the entire ART group, IVF and ICSI groups, and normal cycle-frozen embryo transfer group when compared with those in the controls.
26553447 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma
26503019 the present findings support the conclusion that the E2F1 transcription factor regulates the expression of ADAM12 by binding differential cis-acting elements.
26407179 ADAM12L is associated with epithelial to mesenchymal transition (EMT) and contributes to TGF-beta-dependent EMT.
26051455 Data suggest that low serum levels of ADAM12/hCG may be biomarkers in diagnosis of continued incomplete spontaneous abortion; here, ADAM12/hCG indicate success/failure of single dose of misoprostol/oxytocic in treatment of early pregnancy failure.
25926422 ADAM12 expression is associated with an aggressive molecular subtype of high-grade serous ovarian carcinoma.High serum protein levels of ADAM12 are associated with poor survival in patients with high-grade serous ovarian carcinoma.
25909890 The siRNA-directed loss of ADAM12 impedes spontaneous fusion of primary cytotrophoblasts, whereas overexpression of the secreted variant, ADAM12S, potentiates cell fusion in the Bewo trophoblast cell line.
25886595 The ADAM12-L 3'UTR is a direct target of miR-29 and miR-200 family members.
25667922 Studied the potential role of four SNPs of the ADAM12 gene in susceptibility to knee osteoarthritis and its progression in Chinese Han population.
More...

AA Sequence

MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNI      1 - 70
RLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSG     71 - 140
LRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETL    141 - 210
KATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPF    211 - 280
TSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAH    281 - 350
ELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRE    351 - 420
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCD    421 - 490
LPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYG    491 - 560
NCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPG    561 - 630
LVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGP    631 - 700
IRQADNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGH    701 - 770
LGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKP    771 - 840
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVPRSTHTAYIK     841 - 909
//

Text Mined References (176)

PMID Year Title
26722530 2015 ADAM12 expression predicts clinical outcome in estrogen receptor-positive breast cancer.
26697810 2016 First-trimester maternal serum ADAM12-s and PAPP-A levels are altered in pregnancies conceived after assisted reproduction techniques (ART).
26553447 2016 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma.
26503019 2015 Expression of ADAM12 is regulated by E2F1 in small cell lung cancer.
26407179 2015 The Disintegrin and Metalloprotease ADAM12 Is Associated with TGF-?-Induced Epithelial to Mesenchymal Transition.
26051455 2015 Serum biomarkers may help predict successful misoprostol management of early pregnancy failure.
25926422 2015 ADAM12 is a prognostic factor associated with an aggressive molecular subtype of high-grade serous ovarian carcinoma.
25909890 2015 ADAM12-directed ectodomain shedding of E-cadherin potentiates trophoblast fusion.
25886595 2015 ADAM12-L is a direct target of the miR-29 and miR-200 families in breast cancer.
25667922 2015 Analysis of single nucleotide polymorphisms within ADAM12 and risk of knee osteoarthritis in a Chinese Han population.
More...