Property Summary

NCBI Gene PubMed Count 10
Grant Count 9
R01 Count 9
Funding $867,689.08
PubMed Score 7.95
PubTator Score 10.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
gastric cancer 1.200 0.010
pancreatic cancer 1.700 0.001
malignant mesothelioma -4.100 0.000
psoriasis -1.200 0.000
osteosarcoma -2.114 0.003
posterior fossa group B ependymoma 2.000 0.000
group 4 medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.800 0.009
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.600 0.030
tuberculosis 1.300 0.005
non-small cell lung cancer -2.799 0.000
lung cancer -3.700 0.000
colon cancer -1.900 0.002
interstitial cystitis -1.300 0.002
lung adenocarcinoma -1.400 0.000
pilocytic astrocytoma 1.900 0.000
pancreatic carcinoma 1.700 0.001
subependymal giant cell astrocytoma 1.577 0.013
Breast cancer -1.400 0.033
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.200 0.000
ovarian cancer -4.300 0.000
pituitary cancer -2.000 0.000
head and neck cancer -1.700 0.003

Gene RIF (5)

PMID Text
23251683 Failed ARHGAP6 expression did not appreciably alter the severity of enamel defects when AMELX was absent.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19960375 the RhoGAP6 isoform 1 variant might serve as a biomarker for the development and progression of colorectal cancer
19913121 Observational study of gene-disease association. (HuGE Navigator)
18434237 Human ARHGAP6 protein possessing GTPase stimulating activity for RhoA on the catalytic properties of PLC-delta1, was studied.

AA Sequence

MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGSDEAGAEGSARGATAGRLYSPSL      1 - 70
PAESLGPRLASSSRGPPPRATRLPPPGPLCSSFSTPSTPQEKSPSGSFHFDYEVPLGRGGLKKSMAWDLP     71 - 140
SVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQSPPDSRGHPYVVWKSEGDFTWNSMSGRSVR    141 - 210
LRSVPIQSLSELERARLQEVAFYQLQQDCDLSCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAF    211 - 280
GMPLSQVIANDRAYKLKQDLQRDEQKDASDFVASLLPFGNKRQNKELSSSNSSLSSTSETPNESTSPNTP    281 - 350
EPAPRARRRGAMSVDSITDLDDNQSRLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQH    351 - 420
LEKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLRDMPDPLLTRELYTAFI    421 - 490
NTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVARHADDNISKDGQEVTGNKMTSLNLATIFGP    491 - 560
NLLHKQKSSDKEFSVQSSARAEESTAIIAVVQKMIENYEALFMVPPDLQNEVLISLLETDPDVVDYLLRR    561 - 630
KASQSSSPDMLQSEVSFSVGGRHSSTDSNKASSGDISPYDNNSPVLSERSLLAMQEDAAPGGSEKLYRVP    631 - 700
GQFMLVGHLSSSKSRESSPGPRLGKDLSEEPFDIWGTWHSTLKSGSKDPGMTGSSGDIFESSSLRAGPCS    701 - 770
LSQGNLSPNWPRWQGSPAELDSDTQGARRTQAAAPATEGRAHPAVSRACSTPHVQVAGKAERPTARSEQY    771 - 840
LTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPYPGPGKPAAAAAWIQGPPEGVETPTDQ    841 - 910
GGQAAEREQQVTQKKLSSANSLPAGEQDSPRLGDAGWLDWQRERWQIWELLSTDNPDALPETLV          911 - 974
//

Publication (14)

PMID Year Title
23251683 2012 Amelogenesis imperfecta in two families with defined AMELX deletions in ARHGAP6.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19960375 2010 Identification of Rho GTPase activating protein 6 isoform 1 variant as a new molecular marker in human colorectal tumors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18434237 2008 Regulation of phospholipase C-delta1 by ARGHAP6, a GTPase-activating protein for RhoA: possible role for enhanced activity of phospholipase C in hypertension.
18088087 2008 Phosphoproteome of resting human platelets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12673365 2003 Expression in Escherichia coli of human ARHGAP6 gene and purification of His-tagged recombinant protein.
More...