Property Summary

NCBI Gene PubMed Count 37
Grant Count 287
R01 Count 191
Funding $38,379,166.13
PubMed Score 1317.39
PubTator Score 334.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43175 B2RD08 Q5SZU3 Q9BQ01 3-PGDH
Symbols NLS
PDG
PGD
NLS1
PGAD
PGDH
SERA
3PGDH
3-PGDH
PHGDHD
HEL-S-113

Gene

PANTHER Protein Class (2)

PDB

2G76  

Gene RIF (19)

PMID Text
26439504 High expression of PHGDH is associated with Colon Cancer.
26026368 Overexpression of Phgdh may be generally associated with CK5 cells, and oncogenic function may be determined by isoform expression.
25404730 p53-mediated repression of PHGDH enhances the apoptotic response upon serine starvation in melanoma cells.
25152457 Phosphoglycerate Dehydrogenase deficiency is associated with Neu-Laxova syndrome.
24836451 We report on the identification of homozygous mutations in PHGDH and serine deficiency in individuals with Neu-Laxova syndrome. This disorder thus seems to be an extremely severe expression of PHGDH deficiency.
24247658 PHGDH overexpression is found in cervical cancer, in particular, in bigger tumors and with advanced stages. Its expression is positively correlated with squamous cell carcinoma antigen level
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21981974 The potential mechanisms by which PHGDH promotes cancer are discussed.
21804546 in some cancer cells a relatively large amount of glycolytic carbon is diverted into serine and glycine metabolism through phosphoglycerate dehydrogenase.
21760589 results reveal that certain breast cancers are dependent upon increased serine pathway flux caused by PHGDH overexpression and demonstrate the utility of in vivo negative-selection RNAi screens for finding potential anticancer targets
More...

AA Sequence

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKL      1 - 70
QVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMG     71 - 140
TELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLL    141 - 210
PSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVIS    211 - 280
CPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSP    281 - 350
KGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGE    351 - 420
CLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGV    421 - 490
RLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF                               491 - 533
//

Text Mined References (46)

PMID Year Title
26439504 2015 Clinical Implication of Serine Metabolism-Associated Enzymes in Colon Cancer.
26026368 2015 High level PHGDH expression in breast is predominantly associated with keratin 5-positive cell lineage independently of malignancy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25404730 2015 p53 Protein-mediated regulation of phosphoglycerate dehydrogenase (PHGDH) is crucial for the apoptotic response upon serine starvation.
25152457 2014 Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24836451 2014 Neu-Laxova syndrome, an inborn error of serine metabolism, is caused by mutations in PHGDH.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247658 2013 Expression and clinical significance of phosphoglycerate dehydrogenase and squamous cell carcinoma antigen in cervical cancer.
More...