Property Summary

Ligand Count 93
NCBI Gene PubMed Count 50
PubMed Score 290.10
PubTator Score 156.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.500 8.4e-14
chronic rhinosinusitis -2.309 9.1e-03
cystic fibrosis and chronic rhinosinusit... -2.211 2.9e-02
fibroadenoma 1.400 5.0e-02
glioblastoma -1.100 2.0e-02
head and neck cancer -2.500 6.8e-03
head and neck cancer and chronic obstruc... -2.300 7.3e-04
medulloblastoma -1.500 6.4e-04
non-small cell lung cancer 1.447 7.5e-06
ovarian cancer 1.100 1.7e-10
psoriasis 1.100 2.0e-04
pterygium -1.300 3.4e-03

Gene RIF (34)

AA Sequence

MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM      1 - 70
KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI     71 - 140
MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL    141 - 210
VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE    211 - 280
RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL    281 - 350
EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM    351 - 420
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF    421 - 490
THFHGEI                                                                   491 - 497
//

Text Mined References (51)

PMID Year Title