Property Summary

NCBI Gene PubMed Count 49
Grant Count 54
R01 Count 42
Funding $7,406,701.41
PubMed Score 287.74
PubTator Score 156.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma -1.100 0.020
medulloblastoma -1.500 0.001
non-small cell lung cancer 1.447 0.000
fibroadenoma 1.400 0.050
inflammatory breast cancer -2.500 0.000
pterygium -1.300 0.003
ovarian cancer 1.100 0.000
chronic rhinosinusitis -2.309 0.009
cystic fibrosis and chronic rhinosinusit... -2.211 0.029
head and neck cancer -2.500 0.007
head and neck cancer and chronic obstruc... -2.300 0.001
psoriasis 1.100 0.000

Protein-protein Interaction (1)

Gene RIF (33)

PMID Text
26058854 CYP26A1-mediated oncogenic characteristics may be partially responsible for the elevated expression of fascin.
25839051 CYP26A1 polymorphisms were associated with increased risk of malignant oral disorders in betel quid chewers.
25541526 Molecular recognition of CYP26A1 binding pockets and structure-activity relationship studies for design of potent and selective retinoic acid metabolism blocking agents has been described.
25492813 In liver microsomes, CYP26A1 plays a role in clearing bioactive retinoids.
25294402 data suggested that CYP26A1 overexpression might contribute to the development and progression of cervical malignancies and squamous neoplasia of the head and neck
24819304 HNF4alpha coordinates with retinoic acid receptors in a retinoic acid-dependent manner to strongly induce CYP26A1 gene expression in the liver, which may explain the high level of response to retinoic acid observed in vivo.
24043786 CYP26 is able to inactivate retinoids in serum, preventing retinoic acid signaling and thus bone-marrow hematopoietic stem cell differentiation.
22179182 Our observation suggests an involvement of enhanced CYP26A1 expression causing a functional vitamin A deficieny state in skin that can potentially lead to neoplastic transformation of keratinocytes in an early phase during skin carcinogenesis
22020119 CYP26A1 and CYP26B1 are qualitatively similar retinoic acid hydroxylases with overlapping expression profiles; CYP26A1 has higher catalytic activity than CYP26B1.
21975512 The promoter region of CYP26A1 is significantly hypermethylated in allergic asthmatic subjects.
More...

AA Sequence

MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM      1 - 70
KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI     71 - 140
MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL    141 - 210
VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE    211 - 280
RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL    281 - 350
EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM    351 - 420
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF    421 - 490
THFHGEI                                                                   491 - 497
//

Publication (50)

PMID Year Title
26937021 2016 Identification of Tazarotenic Acid as the First Xenobiotic Substrate of Human Retinoic Acid Hydroxylase CYP26A1 and CYP26B1.
26058854 2015 The retinoic acid-metabolizing enzyme CYP26A1 upregulates fascin and promotes the malignant behavior of breast carcinoma cells.
25839051 2015 Association study between novel CYP26 polymorphisms and the risk of betel quid-related malignant oral disorders.
25541526 2015 Molecular recognition of CYP26A1 binding pockets and structure-activity relationship studies for design of potent and selective retinoic acid metabolism blocking agents.
25492813 2015 Induction of CYP26A1 by metabolites of retinoic acid: evidence that CYP26A1 is an important enzyme in the elimination of active retinoids.
25294402 2014 Increased expression of the retinoic acid-metabolizing enzyme CYP26A1 during the progression of cervical squamous neoplasia and head and neck cancer.
24819304 2014 Hepatocyte nuclear factor 4? (HNF4?) in coordination with retinoic acid receptors increases all-trans-retinoic acid-dependent CYP26A1 gene expression in HepG2 human hepatocytes.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24043786 2013 Regulation of human hematopoietic stem cell self-renewal by the microenvironment's control of retinoic acid signaling.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
More...