Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.88
PubTator Score 7.09

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.72900093199058E-67
posterior fossa group A ependymoma 1511 4.75676568239962E-21
atypical teratoid / rhabdoid tumor 4369 4.3626899501989E-13
adult high grade glioma 2148 4.51965221686397E-7
glioblastoma 5572 1.37253526970072E-6
pilocytic astrocytoma 3086 4.17732577286935E-5
primitive neuroectodermal tumor 3031 4.84461478408378E-5
medulloblastoma, large-cell 6234 2.12299180772624E-4
astrocytic glioma 2241 0.00160059616160237
medulloblastoma 1524 0.0126060729834214
oligodendroglioma 2849 0.0171964475998227
Pick disease 1893 0.0474668154841381


  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.200 0.002
posterior fossa group A ependymoma -4.200 0.000
oligodendroglioma -1.800 0.017
glioblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma -1.400 0.013
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -3.400 0.000
adult high grade glioma -3.300 0.000
pilocytic astrocytoma -2.200 0.000
lung carcinoma 4.800 0.000
Pick disease -1.600 0.047


Accession O43173 A8K0F2 Q6B085 Q9NS41
Symbols SIAT8C



5BO6   5BO7   5BO8   5BO9   5CXY  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (3)

26192331 Data indicate that the crystal structure of ST8SiaIII sialyltransferase show a cluster of polysialyltransferase-specific structural motifs that provide an extended electropositive surface groove for binding of oligo-polysialic acid chain products.
20800603 Observational study of gene-disease association. (HuGE Navigator)
16643848 These results suggest that the expression of hST8Sia III gene via the PI-3K signaling pathway is enhanced during KCl-induced differentiation of U-87 cells by increasing expression of beta-tubulin III.

AA Sequence

QESHQLPAEFQLLYRMHGEGLTKLTLSHCA                                            351 - 380

Text Mined References (9)

PMID Year Title
26192331 2015 Structure of human ST8SiaIII sialyltransferase provides insight into cell-surface polysialylation.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
16643848 2006 Molecular mechanisms involved in transcriptional activation of the human Sia-alpha2,3-Gal-beta1,4-GlcNAc-R:alpha2,8-sialyltransferase (hST8Sia III) gene induced by KCl in human glioblastoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10766765 2000 Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III.
9826427 1998 Cloning and expression of cDNA for a human Sia alpha 2,3Gal beta 1, 4GlcNA:alpha 2,8-sialyltransferase (hST8Sia III).
9073076 1997 Cloning of the cDNA coding for rat brain CMP-NeuAc:GD3 alpha2-8 sialyltransferase.