Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 2
Funding $210,869.8
PubMed Score 9.88
PubTator Score 7.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.200 0.002
posterior fossa group A ependymoma -4.200 0.000
oligodendroglioma -1.800 0.017
glioblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma -1.400 0.013
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -3.400 0.000
adult high grade glioma -3.300 0.000
pilocytic astrocytoma -2.200 0.000
lung carcinoma 4.800 0.000
Pick disease -1.600 0.047

Synonym

Accession O43173 A8K0F2 Q6B085 Q9NS41
Symbols SIAT8C
ST8SiaIII

Gene

PDB

5BO6   5BO7   5BO8   5BO9   5CXY  

Gene RIF (3)

PMID Text
26192331 Data indicate that the crystal structure of ST8SiaIII sialyltransferase show a cluster of polysialyltransferase-specific structural motifs that provide an extended electropositive surface groove for binding of oligo-polysialic acid chain products.
20800603 Observational study of gene-disease association. (HuGE Navigator)
16643848 These results suggest that the expression of hST8Sia III gene via the PI-3K signaling pathway is enhanced during KCl-induced differentiation of U-87 cells by increasing expression of beta-tubulin III.

AA Sequence

MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFRSQFALKFLDP      1 - 70
SFVPITNSLTQELQEKPSKWKFNRTAFLHQRQEILQHVDVIKNFSLTKNSVRIGQLMHYDYSSHKYVFSI     71 - 140
SNNFRSLLPDVSPIMNKHYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFQRDVGRKTNLTTF    141 - 210
NPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGN    211 - 280
IMQHVNRYWKNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKW    281 - 350
QESHQLPAEFQLLYRMHGEGLTKLTLSHCA                                            351 - 380
//

Text Mined References (9)

PMID Year Title
26192331 2015 Structure of human ST8SiaIII sialyltransferase provides insight into cell-surface polysialylation.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
16643848 2006 Molecular mechanisms involved in transcriptional activation of the human Sia-alpha2,3-Gal-beta1,4-GlcNAc-R:alpha2,8-sialyltransferase (hST8Sia III) gene induced by KCl in human glioblastoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10766765 2000 Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III.
9826427 1998 Cloning and expression of cDNA for a human Sia alpha 2,3Gal beta 1, 4GlcNA:alpha 2,8-sialyltransferase (hST8Sia III).
9073076 1997 Cloning of the cDNA coding for rat brain CMP-NeuAc:GD3 alpha2-8 sialyltransferase.