Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.12
PubTator Score 7.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 2.4e-03
astrocytic glioma -2.200 1.6e-03
Astrocytoma, Pilocytic -2.300 1.5e-05
atypical teratoid / rhabdoid tumor -1.500 3.1e-07
ependymoma -3.100 3.2e-03
glioblastoma -3.100 4.0e-09
lung carcinoma 4.800 3.7e-67
medulloblastoma -1.400 1.3e-02
medulloblastoma, large-cell -2.500 2.1e-04
oligodendroglioma -1.800 1.7e-02
Pick disease -1.600 4.7e-02
primitive neuroectodermal tumor -1.300 5.0e-04

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (3)

AA Sequence

MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFRSQFALKFLDP      1 - 70
SFVPITNSLTQELQEKPSKWKFNRTAFLHQRQEILQHVDVIKNFSLTKNSVRIGQLMHYDYSSHKYVFSI     71 - 140
SNNFRSLLPDVSPIMNKHYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFQRDVGRKTNLTTF    141 - 210
NPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGN    211 - 280
IMQHVNRYWKNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKW    281 - 350
QESHQLPAEFQLLYRMHGEGLTKLTLSHCA                                            351 - 380
//

Text Mined References (9)

PMID Year Title