Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 2
Funding $210,869.8
PubMed Score 9.88
PubTator Score 7.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.200 0.002
posterior fossa group A ependymoma -4.200 0.000
oligodendroglioma -1.800 0.017
glioblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma -1.400 0.013
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -3.400 0.000
adult high grade glioma -3.300 0.000
pilocytic astrocytoma -2.200 0.000
lung carcinoma 4.800 0.000
Pick disease -1.600 0.047

Synonym

Accession O43173 A8K0F2 Q6B085 Q9NS41
Symbols SIAT8C
ST8SiaIII

Gene

PDB

5BO6   5BO7   5BO8   5BO9   5CXY  

Protein-protein Interaction (11)

Gene RIF (3)

PMID Text
26192331 Data indicate that the crystal structure of ST8SiaIII sialyltransferase show a cluster of polysialyltransferase-specific structural motifs that provide an extended electropositive surface groove for binding of oligo-polysialic acid chain products.
20800603 Observational study of gene-disease association. (HuGE Navigator)
16643848 These results suggest that the expression of hST8Sia III gene via the PI-3K signaling pathway is enhanced during KCl-induced differentiation of U-87 cells by increasing expression of beta-tubulin III.

AA Sequence

MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFRSQFALKFLDP      1 - 70
SFVPITNSLTQELQEKPSKWKFNRTAFLHQRQEILQHVDVIKNFSLTKNSVRIGQLMHYDYSSHKYVFSI     71 - 140
SNNFRSLLPDVSPIMNKHYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFQRDVGRKTNLTTF    141 - 210
NPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGN    211 - 280
IMQHVNRYWKNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKW    281 - 350
QESHQLPAEFQLLYRMHGEGLTKLTLSHCA                                            351 - 380
//

Publication (9)

PMID Year Title
26192331 2015 Structure of human ST8SiaIII sialyltransferase provides insight into cell-surface polysialylation.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
16643848 2006 Molecular mechanisms involved in transcriptional activation of the human Sia-alpha2,3-Gal-beta1,4-GlcNAc-R:alpha2,8-sialyltransferase (hST8Sia III) gene induced by KCl in human glioblastoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10766765 2000 Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III.
9826427 1998 Cloning and expression of cDNA for a human Sia alpha 2,3Gal beta 1, 4GlcNA:alpha 2,8-sialyltransferase (hST8Sia III).
9073076 1997 Cloning of the cDNA coding for rat brain CMP-NeuAc:GD3 alpha2-8 sialyltransferase.