Property Summary

Ligand Count 5
NCBI Gene PubMed Count 29
PubMed Score 4.52
PubTator Score 13.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 1.0e-06
osteosarcoma 2.186 2.8e-05
ovarian cancer 1.300 8.8e-05

Gene RIF (6)

AA Sequence

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSG      1 - 70
EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVV     71 - 140
GTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQ    141 - 210
MQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIV    211 - 280
FHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLW    281 - 350
DLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGY    351 - 420
HIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAG    421 - 490
HEGKVMGLDISSDGQLIATCSYDRTFKLWMAE                                          491 - 522
//

Text Mined References (32)

PMID Year Title