Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
R01 Count 1
Funding $89,523.29
PubMed Score 7.56
PubTator Score 13.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 2.186 0.000
ovarian cancer 1.300 0.000

Synonym

Accession O43172 O43445 O43864 Q5T1M8 Q96DG2 Q96IK4
Symbols PRP4
RP70
HPRP4
Prp4p
HPRP4P
SNRNP60

Gene

 Grant Application (1)

PDB

3JCR   1MZW  

Gene RIF (6)

PMID Text
25383878 The p.R192H variant of PRPF4 represents a functional null allele which compromises the function of the tri-snRNP, reinforcing the notion that this spliceosomal particle is of crucial importance in the physiology of the retina.
24419317 PRPF4 missense mutations is associated with autosomal dominant retinitis pigmentosa.
24003220 the requirement of enzymatic activity of PRP4 in regulating cancer cell growth and identified an array of potential novel substrates through orthogonal proteomics approaches
18687998 PRP-4 belongs to the serine/threonine protein kinase family, plays a role in pre-mRNA splicing and cell mitosis, and interacts with CLK1
17998396 PRP4 is a spindle assembly checkpoint protein required for MPS1, MAD1, and MAD2 localization to the kinetochores.
11971898 interaction between Hprp3p and Hprp4p

AA Sequence

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSG      1 - 70
EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVV     71 - 140
GTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQ    141 - 210
MQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIV    211 - 280
FHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLW    281 - 350
DLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGY    351 - 420
HIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAG    421 - 490
HEGKVMGLDISSDGQLIATCSYDRTFKLWMAE                                          491 - 522
//

Text Mined References (30)

PMID Year Title
25383878 2014 Identification of a PRPF4 loss-of-function variant that abrogates U4/U6.U5 tri-snRNP integration and is associated with retinitis pigmentosa.
24419317 2014 PRPF4 mutations cause autosomal dominant retinitis pigmentosa.
24003220 2013 Evaluation of cancer dependence and druggability of PRP4 kinase using cellular, biochemical, and structural approaches.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18687998 2008 Lentiviral short hairpin RNA screen of genes associated with multidrug resistance identifies PRP-4 as a new regulator of chemoresistance in human ovarian cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998396 2007 PRP4 is a spindle assembly checkpoint protein required for MPS1, MAD1, and MAD2 localization to the kinetochores.
More...