Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.51
PubTator Score 9.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.992 0.000
intraductal papillary-mucinous neoplasm ... 2.600 0.002
ovarian cancer 1.800 0.003

Synonym

Accession O43169 A8K6B1 Q96CC3 Q9BT35
Symbols OMB5
CYB5-M
CYPB5M

Gene

PANTHER Protein Class (2)

PDB

3NER  

Gene RIF (7)

PMID Text
23703616 Data indicate that mitochondrial amidoxime reducing components 1 and 2 together with the electron transport proteins NADH-cytochrome b5 reductase (CYB5R) and cytochrome b5 (CYB5) catalyze the reduction of N-hydroxylated compounds such as amidoximes.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein cytochrome b5 type B (CYB5B) in cells
21574570 comparison of X-ray crystal structures of human and rat CYB5B reveals a striking difference in packing involving the five-strand beta-sheet, which can be attributed to fully buried residue 21 in strand beta4
20877624 Observational study of gene-disease association. (HuGE Navigator)
20100355 The 21 kDa protein overexpressed in Hodgkin Lymphoma and aggressive non-Hodgkin Lymphomas is identical to CYB5B.
14739275 microsomal cytochrome b5 interacts with neuronal calcium sensor protein visinin-like protein-3 in a Ca2+-dependent manner
11867265 could be involved in the differential modulation of 17 alpha-hydroxylase and 17,20-lyase activities of P450c17 [type2 cyt-b5]

AA Sequence

MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA      1 - 70
SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT     71 - 140
SESKSS                                                                    141 - 146
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23703616 2013 The involvement of mitochondrial amidoxime reducing components 1 and 2 and mitochondrial cytochrome b5 in N-reductive metabolism in human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21574570 2011 Accommodating a nonconservative internal mutation by water-mediated hydrogen bonding between ?-sheet strands: a comparison of human and rat type B (mitochondrial) cytochrome b5.
More...