Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.55
PubTator Score 9.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 2.600 2.2e-03
osteosarcoma 1.992 1.2e-04
ovarian cancer -1.200 1.9e-03

Gene RIF (7)

AA Sequence

MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA      1 - 70
SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT     71 - 140
SESKSS                                                                    141 - 146
//

Text Mined References (24)

PMID Year Title