Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.51
PubTator Score 9.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.15133047898885E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00224932104438453
ovarian cancer 8492 0.00295248094917439

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.992 0.000
intraductal papillary-mucinous neoplasm ... 2.600 0.002
ovarian cancer 1.800 0.003

Synonym

Accession O43169 A8K6B1 Q96CC3 Q9BT35
Symbols OMB5
CYB5-M
CYPB5M

Gene

PANTHER Protein Class (2)

PDB

3NER  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid

Gene RIF (7)

PMID Text
23703616 Data indicate that mitochondrial amidoxime reducing components 1 and 2 together with the electron transport proteins NADH-cytochrome b5 reductase (CYB5R) and cytochrome b5 (CYB5) catalyze the reduction of N-hydroxylated compounds such as amidoximes.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein cytochrome b5 type B (CYB5B) in cells
21574570 comparison of X-ray crystal structures of human and rat CYB5B reveals a striking difference in packing involving the five-strand beta-sheet, which can be attributed to fully buried residue 21 in strand beta4
20877624 Observational study of gene-disease association. (HuGE Navigator)
20100355 The 21 kDa protein overexpressed in Hodgkin Lymphoma and aggressive non-Hodgkin Lymphomas is identical to CYB5B.
14739275 microsomal cytochrome b5 interacts with neuronal calcium sensor protein visinin-like protein-3 in a Ca2+-dependent manner
11867265 could be involved in the differential modulation of 17 alpha-hydroxylase and 17,20-lyase activities of P450c17 [type2 cyt-b5]

AA Sequence

MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA      1 - 70
SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT     71 - 140
SESKSS                                                                    141 - 146
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23703616 2013 The involvement of mitochondrial amidoxime reducing components 1 and 2 and mitochondrial cytochrome b5 in N-reductive metabolism in human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21574570 2011 Accommodating a nonconservative internal mutation by water-mediated hydrogen bonding between ?-sheet strands: a comparison of human and rat type B (mitochondrial) cytochrome b5.
More...