Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.70
PubTator Score 8.62

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.101 2.6e-03
Amyotrophic lateral sclerosis 1.149 1.2e-04
atypical teratoid / rhabdoid tumor -1.300 6.8e-04
Breast cancer 3.600 3.7e-02
colon cancer -1.300 2.4e-03
hereditary spastic paraplegia -1.428 8.9e-03
juvenile dermatomyositis 1.004 9.9e-07
lung cancer -1.100 3.1e-03
medulloblastoma -1.100 8.8e-05
medulloblastoma, large-cell -1.500 2.3e-04
Multiple myeloma 1.809 3.8e-04
osteosarcoma 2.332 6.9e-05
ovarian cancer -2.800 1.6e-08
Parkinson's disease -1.500 1.2e-02

Gene RIF (4)

AA Sequence

MSQYTEKEPAAMDQESGKAVWPKPAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDD      1 - 70
VPKENSSGSSPLDQVDSSLPSEPIFEKSETEIPTCGSALNQTTESSQSFVAVHHSEEGRDTLGSSTNLHN     71 - 140
HSEGEYIPGACSASSVQNGIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNTVFELENREAE    141 - 210
AYTGLSPPVPSFNCEVRDEFEELDSVPLVKSSAGDTEFVHQNSQEIQRSSQDEMVSTKQQNNTSQERQTE    211 - 280
HSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREAL    281 - 350
EVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGATAGRQEVDNTFWNGCGDYYQ    351 - 420
LYDKDEDSSECSDGEWSASLPHRFSGTEKDQSSSDESWETLPGKDENEPELQSDSSGPEEENQELSLQEG    421 - 490
EQTSLEEGEIPWLQYNEVNESSSDEGNEPANEFAQPAFMLDGNNNLEDDSSVSEDLDVDWSLFDGFADGL    491 - 560
GVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDGLPETLVLEDHTAIGQ    561 - 630
EQCCPICCSEYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPAVIEASAAPSSEPDPDAPPS    631 - 700
NDSIAEAP                                                                  701 - 708
//

Text Mined References (24)

PMID Year Title