Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.59
PubTator Score 8.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.809 0.000
osteosarcoma 2.332 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.500 0.000
hereditary spastic paraplegia -1.428 0.009
juvenile dermatomyositis 1.004 0.000
Amyotrophic Lateral Sclerosis 1.149 0.000
acute quadriplegic myopathy 1.101 0.003
lung cancer -1.100 0.003
colon cancer -1.300 0.002
Parkinson's disease -1.500 0.012
Breast cancer 3.600 0.037
ovarian cancer -2.800 0.000

Synonym

Accession O43164 A8K6U4 D3DSZ5 Q68D49 Q8N1G5 Praja2
Symbols RNF131
Neurodap1

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
23931849 Detection of PJA2-FER fusion mRNA is correlated with poor postoperative survival periods in non-small cell lung cancer.
23652010 The RING ligase praja2 ubiquitylates and degrades Mob, a core component of NDR/LATS kinase and a positive regulator of the tumour-suppressor Hippo cascade.
22948757 praja2 is a novel cancer-related gene whose expression is linked to the histotype and mutational status of the thyroid tumor.

AA Sequence

MSQYTEKEPAAMDQESGKAVWPKPAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDD      1 - 70
VPKENSSGSSPLDQVDSSLPSEPIFEKSETEIPTCGSALNQTTESSQSFVAVHHSEEGRDTLGSSTNLHN     71 - 140
HSEGEYIPGACSASSVQNGIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNTVFELENREAE    141 - 210
AYTGLSPPVPSFNCEVRDEFEELDSVPLVKSSAGDTEFVHQNSQEIQRSSQDEMVSTKQQNNTSQERQTE    211 - 280
HSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREAL    281 - 350
EVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGATAGRQEVDNTFWNGCGDYYQ    351 - 420
LYDKDEDSSECSDGEWSASLPHRFSGTEKDQSSSDESWETLPGKDENEPELQSDSSGPEEENQELSLQEG    421 - 490
EQTSLEEGEIPWLQYNEVNESSSDEGNEPANEFAQPAFMLDGNNNLEDDSSVSEDLDVDWSLFDGFADGL    491 - 560
GVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDGLPETLVLEDHTAIGQ    561 - 630
EQCCPICCSEYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPAVIEASAAPSSEPDPDAPPS    631 - 700
NDSIAEAP                                                                  701 - 708
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23931849 2013 Detection of novel paraja ring finger 2-fer tyrosine kinase mRNA chimeras is associated with poor postoperative prognosis in non-small cell lung cancer.
23652010 2013 Proteolysis of MOB1 by the ubiquitin ligase praja2 attenuates Hippo signalling and supports glioblastoma growth.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22948757 2012 Expression of the ring ligase PRAJA2 in thyroid cancer.
21423175 2011 Control of PKA stability and signalling by the RING ligase praja2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...