Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 2
Funding $508,284.5
PubMed Score 174.51
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.900 0.000
osteosarcoma -2.357 0.000
subependymal giant cell astrocytoma 1.033 0.015

Synonym

Accession O43159 Q7KZ78 Q9BVM6
Symbols NML
KIAA0409

Gene

PDB

2ZFU  

Gene RIF (4)

PMID Text
26505814 Breast tumors without detectable nucleolar NML expression had poor survival.
26098692 Among Systemic lupus erythematosus patients, 63.6% and 45.5% of those with lupus nephritis were positive for anti-RRP8 and anti-TNP1 antibodies, compared with 12.5% and 9.4% of Systemic lupus erythematosus patients without nephritis, respectively.
23897426 Data indicate that the the nucleomethylin (NML)-SirT1 interaction was competitively inhibited by rRNA.
19819226 These observations suggest that NML may regulate consumption of hepatic triglyceride in liver regeneration after partial hepatectomy due to storage of excess ATP.

AA Sequence

MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAASLSQHPPSLCISDSEEEEEE      1 - 70
RKKKCPKKASFASASAEVGKKGKKKCQKQGPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHA     71 - 140
PINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQ    141 - 210
APAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLY    211 - 280
HRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQV    281 - 350
PLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLT    351 - 420
NSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYKRR                                      421 - 456
//

Publication (23)

PMID Year Title
26505814 2015 Nucleolar repression facilitates initiation and maintenance of senescence.
26098692 2015 Novel Autoantigens Associated with Lupus Nephritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23897426 2013 Regulation of SirT1-nucleomethylin binding by rRNA coordinates ribosome biogenesis with nutrient availability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21471221 2011 Novel nucleolar pathway connecting intracellular energy status with p53 activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19819226 2009 The nucleolar protein NML regulates hepatic ATP levels during liver regeneration after partial hepatectomy.
More...