Property Summary

NCBI Gene PubMed Count 18
PubMed Score 184.29
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.1e-09
psoriasis 6694 3.1e-04
subependymal giant cell astrocytoma 2287 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lymphosarcoma 4 4.596 2.3
Breast abscess 5 3.914 2.0
Bowen-Conradi syndrome 16 3.847 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.357 1.1e-09
psoriasis -1.900 3.1e-04
subependymal giant cell astrocytoma 1.033 1.5e-02

Gene RIF (5)

AA Sequence

MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAASLSQHPPSLCISDSEEEEEE      1 - 70
RKKKCPKKASFASASAEVGKKGKKKCQKQGPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHA     71 - 140
PINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQ    141 - 210
APAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLY    211 - 280
HRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQV    281 - 350
PLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLT    351 - 420
NSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYKRR                                      421 - 456
//

Text Mined References (24)

PMID Year Title