Property Summary

NCBI Gene PubMed Count 65
PubMed Score 64.53
PubTator Score 194.41

Knowledge Summary


No data available


  Disease (5)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 5.7e-06
osteosarcoma 7950 6.0e-05
Down syndrome 499 2.7e-04
ependymoma 4679 9.3e-04
oligodendroglioma 2850 1.2e-03
astrocytic glioma 2597 3.3e-02
subependymal giant cell astrocytoma 2287 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 3.106 1.6


  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 3.3e-02
Down syndrome 1.400 2.7e-04
ependymoma 2.000 9.3e-04
oligodendroglioma 1.500 1.2e-03
osteosarcoma 1.256 6.0e-05
ovarian cancer -1.200 5.7e-06
subependymal giant cell astrocytoma -1.098 3.5e-02

Protein-protein Interaction (5)

Gene RIF (50)

AA Sequence

QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL                                      2101 - 2135

Text Mined References (71)

PMID Year Title