Property Summary

NCBI Gene PubMed Count 60
PubMed Score 58.94
PubTator Score 194.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 5.74115865800221E-6
osteosarcoma 7933 5.99734283881475E-5
Down syndrome 548 2.72474221581839E-4
ependymoma 2514 9.25320220073914E-4
oligodendroglioma 2849 0.00121174585239606
astrocytic glioma 2241 0.0328890468102837
subependymal giant cell astrocytoma 2287 0.0354846055639903
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 3.043 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 0.033
ependymoma 2.000 0.001
oligodendroglioma 1.500 0.001
osteosarcoma 1.256 0.000
subependymal giant cell astrocytoma -1.098 0.035
ovarian cancer -1.200 0.000
Down syndrome 1.400 0.000

Synonym

Accession O43157 A6H8Y2 Q6NY20 Q9UIV7 Q9UJ92 Q9UJ93
Symbols SEP
PLXN5
PLEXIN-B1

Gene

PDB

2JPH   2OS6   2R2O   2REX   3HM6   3OL2   3SU8   3SUA  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (45)

PMID Text
26341082 Dysregulation of the vascular endothelial growth factor and semaphorin ligand-receptor families in prostate cancer metastasis
26275342 Blocking of CD100, plexin B1 and/or B2 in adhesion experiments have shown that both CD100 and plexins act as adhesion molecules involved in monocyte-endothelial cell binding.
26051877 Plexin-B1 induces cutaneous squamous cell carcinoma cell proliferation, migration, and invasion by interacting with Sema4D. Plexin-B1 might serve as a useful biomarker and/or as a novel therapeutic target for cSCC.
26035216 Results show that decreased expression of Sema4D, plexin-B1 and -B2 was associated with local recurrence and poor prognosis of breast neoplasm.
25982277 results show that Sema4D/plexin-B1 signaling promotes the translocation of androgen receptor to the nucleus and thereby enhances AR transcriptional activity
24114199 The Semaphorin 4D-Plexin-B1-RhoA signaling axis recruits pericytes and regulates vascular permeability through endothelial production of PDGF-B and ANGPTL4.
23775445 Activation of endogenous plexin-B1 enhances cell migration and tumor invasiveness in prostate cancer cells.
23603360 Data indicate that Rnd1 efficiently displaces Rac1 from its complex with Plexin-B1 but not vice versa.
22404908 PlexinB1 mutations block plexinB1-mediated signalling pathways that inhibit cell motility.
22378040 ErbB-2 overexpression in human breast & ovarian cancer cell lines leads to phosphorylation & activation of Plexin-B1. This was required for ErbB-2-dependent activation of RhoA & RhoC & promoted invasive behavior.
More...

AA Sequence

MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVST      1 - 70
GPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDT     71 - 140
QYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGR    141 - 210
LSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAA    211 - 280
VATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDG    281 - 350
TEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF    351 - 420
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCAS    421 - 490
CLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMSPANISREETREVFLSVPDLP    491 - 560
PLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFYDCV    561 - 630
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKA    631 - 700
LATPAPDTLPVEPGAPSTATASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGT    701 - 770
AVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD    771 - 840
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGLWELEEATLGA    841 - 910
SSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVVEARVECEPPPDTQCHVT    911 - 980
CQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWCEGERPR    981 - 1050
CVTREACGEAEAVATQCPAPLIHSVEPLTGPVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEY   1051 - 1120
EVSSSLVCITGASGEEVAGATAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTG   1121 - 1190
RLEDIRVVVGDQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT   1191 - 1260
KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQFEEPCHVN   1261 - 1330
SSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPLNPEDPTMPFRHKPGSVF   1331 - 1400
SVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPRHHALREAPDSLPEFTVQMGNLRF   1401 - 1470
SLGHVQYDGESPGAFPVAAQVGLGVGTSLLALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRC   1471 - 1540
KKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLL   1541 - 1610
NSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE   1611 - 1680
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLT   1681 - 1750
LNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDE   1751 - 1820
DVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPS   1821 - 1890
DEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDE   1891 - 1960
QAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRD   1961 - 2030
SPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD   2031 - 2100
QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL                                      2101 - 2135
//

Text Mined References (66)

PMID Year Title
26341082 2015 Dysregulation of the vascular endothelial growth factor and semaphorin ligand-receptor families in prostate cancer metastasis.
26275342 2015 CD100 and plexins B2 and B1 mediate monocyte-endothelial cell adhesion and might take part in atherogenesis.
26051877 2015 Plexin-B1 and semaphorin 4D cooperate to promote cutaneous squamous cell carcinoma cell proliferation, migration and invasion.
26035216 2015 Reduced expression of semaphorin 4D and plexin-B in breast cancer is associated with poorer prognosis and the potential linkage with oestrogen receptor.
25982277 2016 Plexin-B1 signalling promotes androgen receptor translocation to the nucleus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24114199 2014 The Semaphorin 4D-Plexin-B1-RhoA signaling axis recruits pericytes and regulates vascular permeability through endothelial production of PDGF-B and ANGPTL4.
23775445 2013 Function of mutant and wild-type plexinb1 in prostate cancer cells.
23603360 2013 Interaction characteristics of Plexin-B1 with Rho family proteins.
22404908 2012 Effect of cancer-associated mutations in the PlexinB1 gene.
More...