Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.09
PubTator Score 6.80

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 5.54488173258654E-7
ovarian cancer 8492 4.70059615035112E-5
lung cancer 4473 0.00447032717002333
osteosarcoma 7933 0.00464842254640514
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.120 0.005
lung cancer 1.400 0.004
ovarian cancer 1.400 0.000


Accession O43156 D6W4K3 Q5JX67 Q96A38 Q9BR47 Q9H4K0
Symbols smg-10


  Ortholog (15)

Gene RIF (4)

24657168 IP7, formed by IP6K2, binds CK2 to enhance its phosphorylation of the Tti1/Tel2 complex, thereby stabilizing DNA-PKcs and ATM. This process stimulates p53 phosphorylation at serine 15 to activate the cell death program.
20810650 TTI1 and TTI2 protect cells from spontaneous DNA damage, and are required for the establishment of the intra-S and G2/M checkpoin
20800603 Observational study of gene-disease association. (HuGE Navigator)
20427287 Data show that that knockdown of either Tti1 or Tel2 causes disassembly of mTORC1 and mTORC2.

AA Sequence

CPVQFTPPHPSLHPVQLHGASGQQNPYTTNVLQLLKELQ                                  1051 - 1089

Text Mined References (17)

PMID Year Title
24657168 2014 Inositol pyrophosphates mediate the DNA-PK/ATM-p53 cell death pathway by regulating CK2 phosphorylation of Tti1/Tel2.
23263282 2013 SCFFbxo9 and CK2 direct the cellular response to growth factor withdrawal via Tel2/Tti1 degradation and promote survival in multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20810650 2010 A genetic screen identifies the Triple T complex required for DNA damage signaling and ATM and ATR stability.
20801936 2010 Tel2 structure and function in the Hsp90-dependent maturation of mTOR and ATR complexes.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20427287 2010 Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly.
20371770 2010 AAA+ proteins RUVBL1 and RUVBL2 coordinate PIKK activity and function in nonsense-mediated mRNA decay.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.