Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.62
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.800 1.9e-02
astrocytic glioma -1.300 8.3e-03
Breast cancer -1.800 3.6e-11
breast carcinoma -1.100 1.4e-13
colon cancer -1.700 2.6e-04
cystic fibrosis 1.190 3.7e-04
ependymoma -3.000 1.1e-02
glioblastoma -1.600 1.9e-03
group 4 medulloblastoma -1.200 9.3e-04
hereditary spastic paraplegia -1.009 4.9e-02
intraductal papillary-mucinous adenoma (... -2.000 2.3e-05
intraductal papillary-mucinous carcinoma... -2.000 2.0e-05
intraductal papillary-mucinous neoplasm ... -2.100 5.4e-04
invasive ductal carcinoma -1.100 1.0e-02
juvenile dermatomyositis 1.048 1.4e-06
malignant mesothelioma -4.100 1.3e-09
oligodendroglioma -2.100 1.3e-02
osteosarcoma -1.835 2.2e-02
ovarian cancer -2.600 5.8e-17
pancreatic cancer -1.400 2.9e-03
Pick disease 1.900 1.6e-05
tuberculosis -1.100 1.4e-03
ulcerative colitis 1.200 7.1e-03

Gene RIF (4)

AA Sequence

MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYL      1 - 70
HNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENNIQTISRAALAQLLKLEELHL     71 - 140
DDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLI    141 - 210
VDGNLLTNKGIAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLER    211 - 280
LDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAV    281 - 350
RELNMNLLSCPTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPP    351 - 420
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYR    421 - 490
ICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGAVIFVLVVLLS    491 - 560
VFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTP    561 - 630
NGGINYTDCHIPNNMRYCNSSVPDLEHCHT                                            631 - 660
//

Text Mined References (25)

PMID Year Title