Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.86
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -4.100 0.000
astrocytoma -1.500 0.000
ependymoma -3.000 0.011
oligodendroglioma -2.100 0.013
glioblastoma -2.500 0.003
osteosarcoma -1.835 0.022
cystic fibrosis 1.190 0.000
hereditary spastic paraplegia -1.009 0.049
juvenile dermatomyositis 1.048 0.000
tuberculosis -1.100 0.001
intraductal papillary-mucinous adenoma (... -5.000 0.000
intraductal papillary-mucinous carcinoma... -5.900 0.000
intraductal papillary-mucinous neoplasm ... -6.000 0.000
colon cancer -1.700 0.000
pancreatic cancer -1.400 0.003
pediatric high grade glioma -1.800 0.007
group 4 medulloblastoma -2.600 0.001
breast carcinoma -1.500 0.000
Pick disease 1.900 0.000
Breast cancer -1.800 0.000
invasive ductal carcinoma -2.800 0.000
ulcerative colitis 1.200 0.007
ovarian cancer -6.300 0.000

Synonym

Accession O43155 A0AV84 B7ZLP3
Symbols

Gene

Gene RIF (3)

PMID Text
24732660 PCMC expression of ADAM29, FLRT2, and SLC18A3 could be assessed as part of a routine screen to help identify individuals at risk of severe Obstructive sleep apnea in Asian populations
22747982 The membrane protein, FLRT2, was identified as a novel autoantigen in systemic lupus erythematosus patients.
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYL      1 - 70
HNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENNIQTISRAALAQLLKLEELHL     71 - 140
DDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLI    141 - 210
VDGNLLTNKGIAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLER    211 - 280
LDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAV    281 - 350
RELNMNLLSCPTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPP    351 - 420
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYR    421 - 490
ICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGAVIFVLVVLLS    491 - 560
VFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTP    561 - 630
NGGINYTDCHIPNNMRYCNSSVPDLEHCHT                                            631 - 660
//

Text Mined References (25)

PMID Year Title
27091502 2016 Super-complexes of adhesion GPCRs and neural guidance receptors.
26890304 2016 Methylation profiling identified novel differentially methylated markers including OPCML and FLRT2 in prostate cancer.
26633812 2015 An extracellular biochemical screen reveals that FLRTs and Unc5s mediate neuronal subtype recognition in the retina.
25728924 2015 Structural basis of latrophilin-FLRT interaction.
24732660 Gene expression profiles in peripheral blood mononuclear cells of Asian obstructive sleep apnea patients.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...