Property Summary

NCBI Gene PubMed Count 27
Grant Count 19
R01 Count 12
Funding $2,046,414.1
PubMed Score 66.75
PubTator Score 33.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26838672 TET3 expression inhibits glioblastoma tumorigenesis and self-renewal in glioblastoma stem cells.
26703470 these data show that hypoxia-inducible genes are regulated in a multilayered manner that includes epigenetic regulation via TETs and 5-hmC levels in addition to HIF stabilization.
26294212 Hypoxia deregulates TET3. TET1/3 levels were associated with tumor hypoxia, tumor malignancy, and poor prognosis in breast cancer patients. Coordinate functions of TET1 and TET3 were needed to activate TNFalpha-p38-MAPK signaling in hypoxia.
26207381 levels of TET3 and TDG mRNAs were independent prognostic factors for early breast cancer patients who received anthracycline chemotherapy
25568311 TET1, TET2, and TET3 are highly phosphorylated.
25550811 In hepatic stellate cells, cell proliferation rise significantly and cell apoptosis reduce obviously after knockdown of TET3.
25089631 GABRA3 also carries a microRNA (miR-767) with predicted target sites in TET1 and TET3, two members of the ten-eleven-translocation family of tumor suppressor genes, involved in the conversion of 5-methylcytosines to 5-hydroxymethylcytosines in DNA.
24958354 TET1 depletion yields widespread reduction of 5hmC, while depletion of TET2 and TET3 reduces 5hmC at a subset of TET1 targets suggesting functional co-dependence.
24394411 OGT catalyzes the O-GlcNAcylation of TET3, promotes TET3 nuclear export, and, consequently, inhibits the formation of 5-hydroxymethylcytosine catalyzed by TET3.
24304661 TET3 enhanced its localization to chromatin through the stabilization of OGT protein.
More...

AA Sequence

MDSGPVYHGDSRQLSASGVPVNGAREPAGPSLLGTGGPWRVDQKPDWEAAPGPAHTARLEDAHDLVAFSA      1 - 70
VAEAVSSYGALSTRLYETFNREMSREAGNNSRGPRPGPEGCSAGSEDLDTLQTALALARHGMKPPNCNCD     71 - 140
GPECPDYLEWLEGKIKSVVMEGGEERPRLPGPLPPGEAGLPAPSTRPLLSSEVPQISPQEGLPLSQSALS    141 - 210
IAKEKNISLQTAIAIEALTQLSSALPQPSHSTPQASCPLPEALSPPAPFRSPQSYLRAPSWPVVPPEEHS    211 - 280
SFAPDSSAFPPATPRTEFPEAWGTDTPPATPRSSWPMPRPSPDPMAELEQLLGSASDYIQSVFKRPEALP    281 - 350
TKPKVKVEAPSSSPAPAPSPVLQREAPTPSSEPDTHQKAQTALQQHLHHKRSLFLEQVHDTSFPAPSEPS    351 - 420
APGWWPPPSSPVPRLPDRPPKEKKKKLPTPAGGPVGTEKAAPGIKPSVRKPIQIKKSRPREAQPLFPPVR    421 - 490
QIVLEGLRSPASQEVQAHPPAPLPASQGSAVPLPPEPSLALFAPSPSRDSLLPPTQEMRSPSPMTALQPG    491 - 560
STGPLPPADDKLEELIRQFEAEFGDSFGLPGPPSVPIQDPENQQTCLPAPESPFATRSPKQIKIESSGAV    561 - 630
TVLSTTCFHSEEGGQEATPTKAENPLTPTLSGFLESPLKYLDTPTKSLLDTPAKRAQAEFPTCDCVEQIV    631 - 700
EKDEGPYYTHLGSGPTVASIRELMEERYGEKGKAIRIEKVIYTGKEGKSSRGCPIAKWVIRRHTLEEKLL    701 - 770
CLVRHRAGHHCQNAVIVILILAWEGIPRSLGDTLYQELTDTLRKYGNPTSRRCGLNDDRTCACQGKDPNT    771 - 840
CGASFSFGCSWSMYFNGCKYARSKTPRKFRLAGDNPKEEEVLRKSFQDLATEVAPLYKRLAPQAYQNQVT    841 - 910
NEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPEDEQLHVLPL    911 - 980
YKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPE    981 - 1050
KIKQEALELAGITSDPGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMN   1051 - 1120
SVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLHALH   1121 - 1190
NSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLHSVSRDPSPFAQSSNCYNRS   1191 - 1260
IKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGVFSSGESP   1261 - 1330
AIVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPW   1331 - 1400
ALGAGDFNSALKGSPGFQDKLWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDP   1401 - 1470
FSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAPAHGSILIECARRELHAT   1471 - 1540
TPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQEAKLYGKKRK   1541 - 1610
WGGTVVAEPQQKEKKGVVPTRQALAVPTDSAVTVSSYAYTKVTGPYSRWI                       1611 - 1660
//

Text Mined References (29)

PMID Year Title
26838672 2016 Downregulation of TLX induces TET3 expression and inhibits glioblastoma stem cell self-renewal and tumorigenesis.
26703470 2016 Fumarate and Succinate Regulate Expression of Hypoxia-inducible Genes via TET Enzymes.
26294212 2015 Hypoxia Drives Breast Tumor Malignancy through a TET-TNF?-p38-MAPK Signaling Axis.
26207381 2015 Reduced Expression of TET1, TET2, TET3 and TDG mRNAs Are Associated with Poor Prognosis of Patients with Early Breast Cancer.
25568311 2015 Phosphorylation of TET proteins is regulated via O-GlcNAcylation by the O-linked N-acetylglucosamine transferase (OGT).
25550811 2014 TET3 mediates the activation of human hepatic stellate cells via modulating the expression of long non-coding RNA HIF1A-AS1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25089631 2014 A novel cancer-germline transcript carrying pro-metastatic miR-105 and TET-targeting miR-767 induced by DNA hypomethylation in tumors.
24958354 2014 Distinct and overlapping control of 5-methylcytosine and 5-hydroxymethylcytosine by the TET proteins in human cancer cells.
24394411 2014 Differential regulation of the ten-eleven translocation (TET) family of dioxygenases by O-linked ?-N-acetylglucosamine transferase (OGT).
More...