Property Summary

NCBI Gene PubMed Count 30
PubMed Score 55.51
PubTator Score 37.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Leukemia, Myeloid, Acute 105 0.0 0.0
Disease Target Count
Leukemia, Myelocytic, Acute 120
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.024 1.8e-05
dermatomyositis 1.300 1.7e-03
glioblastoma 1.300 2.1e-02
group 3 medulloblastoma 1.500 3.1e-03
lung adenocarcinoma 1.107 3.2e-08
lung cancer 1.100 1.9e-02
medulloblastoma, large-cell 1.100 2.0e-04
Multiple myeloma 1.004 9.4e-04
ovarian cancer -2.000 7.8e-06
Waldenstrons macroglobulinemia 1.176 4.6e-03

Gene RIF (9)

AA Sequence

MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLI      1 - 70
SAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVW     71 - 140
EYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMD    141 - 210
VMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVV    211 - 280
RQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEG    281 - 350
DLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVS    351 - 420
TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAY    421 - 490
KTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGS    491 - 560
MMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNV    561 - 630
YHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQ    631 - 700
VAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSN    701 - 770
FPQCEAKRQLDRIIAKLQSKEYSQY                                                 771 - 795
//

Text Mined References (37)

PMID Year Title