Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
25384438 downregulation of expression in the skin from Lichen planus patients
23662747 Expression of human endogenous retrovirus HERV-K18 is associated with clinical severity in osteoarthritis patients.

AA Sequence

MVTPVTWMDNPIEVYVNDSVWVPGPTDDRCPAKPEEEGMMINISIGYHYPPICLGRAPGCLMPAVQNWLV      1 - 70
EVPTVSPNSRFTYHMVSGMSLRPRVNCLQDFSYQRSLKFRPKGKTCPKEIPKGSKNTEVLVWEECVANSV     71 - 140
VILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYLWEWEEKGIS    141 - 210
TPRPKIISPVSGPEHPELWRLTVASHHIRIWSGNQTLETRYRKPFYTIDLNSILTVPLQSCVKPPYMLVV    211 - 280
GNIVIKPASQTITCENCRLFTCIDSTFNWQHRILLVRAREGMWIPVSTDRPWEASPSIHILTEILKGVLN    281 - 350
RSKRFIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNYWQKNSTRLWNSQSSIDQKLASQINDLRQ    351 - 420
TVIWMGDRLMTLEHHFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFEAS    421 - 490
KAHLNLVPGTEAIAGVADGLANLNPVTWIKTIRSTMIINLILIVVCLFCLLLVCRCTQQLRRDSDIENGP    491 - 560
//

Text Mined References (16)

PMID Year Title
25384438 2015 Human endogenous retrovirus expression is inversely related with the up-regulation of interferon-inducible genes in the skin of patients with lichen planus.
23662747 2013 Expression of human endogenous retrovirus HERV-K18 is associated with clinical severity in osteoarthritis patients.
23634223 2013 Role of the human endogenous retrovirus HERV-K18 in autoimmune disease susceptibility: study in the Spanish population and meta-analysis.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
14988274 2004 Association of human endogenous retrovirus K-18 polymorphisms with type 1 diabetes.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
11982593 2002 Autoantibodies to human endogenous retrovirus-K are frequently detected in health and disease and react with multiple epitopes.
11841850 2002 Human endogenous retrovirus IDDMK(1,2)22 and mouse mammary tumor virus superantigens differ in their ability to stimulate murine T cell hybridomas.
11776384 2001 Identification of nonsynonymous polymorphisms in the superantigen-coding region of IDDMK1,2 22 and a pilot study on the association between IDDMK1,2 22 and type 1 diabetes.
More...