Property Summary

Ligand Count 56
NCBI Gene PubMed Count 124
PubMed Score 312.27
PubTator Score 272.23

Knowledge Summary

Patent (12,038)

TINX Plot

  Disease (7)

Expression

  Differential Expression (15)

Gene RIF (112)

AA Sequence

MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTF      1 - 70
LLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQP     71 - 140
WPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLG    141 - 210
LTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTAL    211 - 280
LVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINA    281 - 350
FRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP    351 - 420
EPSQQSK                                                                   421 - 427
//

Text Mined References (126)

PMID Year Title