Property Summary

NCBI Gene PubMed Count 110
Grant Count 76
R01 Count 58
Funding $6,356,058.54
PubMed Score 284.04
PubTator Score 272.23

Knowledge Summary

Patent (12,038)

Expression

Synonym

Accession O15554 Q53XR4 SK4
Symbols IK
IK1
SK4
DHS2
KCA4
hSK4
IKCA1
hKCa4
KCa3.1
hIKCa1

Gene

Gene RIF (98)

PMID Text
27092946 KCa3.1 and CFTR colocalize at the plasma membrane.
26824610 KCNN4 inhibition differentially regulates migration of intestinal epithelial cells in inflamed vs. non-inflamed conditions in a PI3K/Akt-mediated manner.
26689552 KCa3.1 protein expression was increased in asthmatic compared to healthy airway epithelium in situ, and KCa3.1 currents were larger in asthmatic compared to healthy HBECs cultured in vitro
26418693 Data show that calcium-dependent potassium channel KCa3.1 operates as a positive feedback mechanism for intracellular Ca2+ increase.
26198474 describes patients from 2 well-phenotyped hereditary xerocytosis (HX) kindreds, including from one of the first HX kindreds described, who lack predicted heterozygous PIEZO1-linked variants
26178367 Novel Gardos channel mutations linked to dehydrated hereditary stomatocytosis (xerocytosis).
26177720 KCa3.1 activation in human lung mast cells is highly dependent on Ca(2+) influx through Orai1 channels, mediated via a close spatiotemporal interaction between the two channels.
26148990 identification of a dominantly inherited missense mutation in the Gardos channel in 2 unrelated families and its association with chronic hemolysis and dehydrated cells, also referred to as hereditary xerocytosis
26138196 that KCa3.1 channels are key actors in the migration capacity of neutrophils, and its inhibition did not affect other relevant cellular functions
25848765 high KCa3.1-mRNA expression levels were indicative of low disease specific survival of ccRCC patients, short progression-free survival, and a high metastatic potential. Therefore, KCa3.1 is of prognostic value in ccRCC
More...

AA Sequence

MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTF      1 - 70
LLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQP     71 - 140
WPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLG    141 - 210
LTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTAL    211 - 280
LVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINA    281 - 350
FRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP    351 - 420
EPSQQSK                                                                   421 - 427
//

Text Mined References (112)

PMID Year Title
27092946 2016 Investigating CFTR and KCa3.1 Protein/Protein Interactions.
26824610 2016 K+ Channel Inhibition Differentially Regulates Migration of Intestinal Epithelial Cells in Inflamed vs. Non-Inflamed Conditions in a PI3K/Akt-Mediated Manner.
26689552 2015 KCa3.1 K+ Channel Expression and Function in Human Bronchial Epithelial Cells.
26418693 2015 KCa3.1-Dependent Hyperpolarization Enhances Intracellular Ca2+ Signaling Induced by fMLF in Differentiated U937 Cells.
26198474 2015 Mutations in the Gardos channel (KCNN4) are associated with hereditary xerocytosis.
26178367 2015 Novel Gardos channel mutations linked to dehydrated hereditary stomatocytosis (xerocytosis).
26177720 2015 Orai/CRACM1 and KCa3.1 ion channels interact in the human lung mast cell plasma membrane.
26148990 2015 A mutation in the Gardos channel is associated with hereditary xerocytosis.
26138196 2016 The calcium-activated potassium channel KCa3.1 plays a central role in the chemotactic response of mammalian neutrophils.
25848765 2015 High expression of KCa3.1 in patients with clear cell renal carcinoma predicts high metastatic risk and poor survival.
More...