Property Summary

NCBI Gene PubMed Count 37
Grant Count 2
R01 Count 1
Funding $62,258.62
PubMed Score 99.14
PubTator Score 60.47

Knowledge Summary

Patent (9,122)

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.045
Multiple Sclerosis 1.200 0.025
interstitial cystitis 1.200 0.008
ulcerative colitis 2.000 0.002
psoriasis 1.400 0.000

Synonym

Accession O15552 B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5
Symbols FFA2R
GPR43

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (1)

Gene RIF (24)

PMID Text
26518871 Although both agonist and antagonist ligands contain negatively charged carboxylates that interact with two key positively charged arginine residues in transmembrane domains V and VII of FFA2, there are clear differences in how these interactions occur.
26075576 FFAR2 signaling occurs by divergent G protein pathways.
26023106 GPR3 agonism potentiates insulin secretion in isolated islets.
25633224 GPR43 expression is reduced in monocytes upon siRNA-knockdown of XBP1, while A549 cells overexpressing XBP1 displayed elevated GPR43 levels.
25581519 FFAR2 is expressed in pancreatic beta cells and mediates an inhibition of insulin secretion by coupling to Gi-type G proteins.
25298143 FFAR2 is a potential therapeutic target of T1 diabetes, representing a link between immune response and glucose homeostasis.
24458110 [review] In vivo and in vitro studies suggest that short-chain fatty acid receptors (SCFAs) stimulate gut hormone secretion; therefore, the SCFA-FFA signal is likely to be important for gut physiological functions.
23985900 GPR43 modulates NF-kappaB activity via beta-arrestin 2.
23066016 Extracellular ionic locks determine variation in constitutive activity and ligand potency between species orthologs of the free fatty acid receptors FFA2 and FFA3
22919070 Data indicate that a single mutation in human FFA2 of C4.57G resulted in a human FFA2 receptor with ligand selectivity similar to the bovine receptor.
More...

AA Sequence

MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAA      1 - 70
SNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGH     71 - 140
CTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQP    141 - 210
LVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVV    211 - 280
RRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE                        281 - 330
//

Text Mined References (37)

PMID Year Title
26518871 2016 Non-equivalence of Key Positively Charged Residues of the Free Fatty Acid 2 Receptor in the Recognition and Function of Agonist Versus Antagonist Ligands.
26075576 2015 An Acetate-Specific GPCR, FFAR2, Regulates Insulin Secretion.
26023106 2015 GPR43 Potentiates ?-Cell Function in Obesity.
25633224 2015 The short-chain fatty acid receptor GPR43 is transcriptionally regulated by XBP1 in human monocytes.
25581519 2015 Loss of FFA2 and FFA3 increases insulin secretion and improves glucose tolerance in type 2 diabetes.
25298143 2014 Free fatty acid receptor 2, a candidate target for type 1 diabetes, induces cell apoptosis through ERK signaling.
24458110 2014 Short-chain fatty acid receptor and its contribution to glucagon-like peptide-1 release.
23985900 2013 ?-Arrestin 2 mediates G protein-coupled receptor 43 signals to nuclear factor-?B.
23589301 2013 Defining the molecular basis for the first potent and selective orthosteric agonists of the FFA2 free fatty acid receptor.
23066016 2012 Extracellular ionic locks determine variation in constitutive activity and ligand potency between species orthologs of the free fatty acid receptors FFA2 and FFA3.
More...