Property Summary

NCBI Gene PubMed Count 82
Grant Count 55
R01 Count 29
Funding $5,226,548.39
PubMed Score 205.46
PubTator Score 109.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (64)

PMID Text
26340953 localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua
26148935 Cln-3 plays a vital role in TNF-modulated paracellular permeability in submandibular epithelium.
25849148 Data from live-cell imaging suggest at least two different cis-interaction interfaces within CLDN3 homopolymers as well as within CLDN1/CLDN3 heteropolymers.
25820701 Univariate analyses indicated that the T stage, lymph node metastasis, the TNM stage, and the expression of claudin-3, beta-catenin, and vimentin were significant predictors for overall survival (OS).
25755790 increased claudin-3 and claudin-4 expression may play a postive role in the progression and metastasis of gastric cancer
25744656 Further in vitro studies suggested that the isolated MAbs possessed the desired binding properties for the detection or targeting of CLDN3.
25319490 The expressions of MARVELD2, CLDN1 and CLDN3 mRNA were significantly lower in cholesteatoma tissue and may be involved in epithelium permeability.
25277196 our findings demonstrated that CLDN3 is an epigenetically silenced metastasis suppressor gene in Hepatocellular carcinoma
24974365 that Claudin-3 expression was restricted to the apical pole of ependymocytes in the subcommissural organ
24840331 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
More...

AA Sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLL      1 - 70
ALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSAN     71 - 140
TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASL    141 - 210
GTGYDRKDYV                                                                211 - 220
//

Text Mined References (83)

PMID Year Title
26340953 2015 Claudin-3, claudin-7, and claudin-10 show different distribution patterns during decidualization and trophoblast invasion in mouse and human.
26148935 2015 Claudin-3 is required for modulation of paracellular permeability by TNF-? through ERK1/2/slug signaling axis in submandibular gland.
25849148 2015 Probing the cis-arrangement of prototype tight junction proteins claudin-1 and claudin-3.
25820701 2015 Decreased expression of claudin-3 is associated with a poor prognosis and EMT in completely resected squamous cell lung carcinoma.
25755790 2015 The expression patterns of tight junction protein claudin-1, -3, and -4 in human gastric neoplasms and adjacent non-neoplastic tissues.
25744656 2015 Generation of specific monoclonal antibodies against the extracellular loops of human claudin-3 by immunizing mice with target-expressing cells.
25319490 2015 Increased permeability of the epithelium of middle ear cholesteatoma.
25277196 2014 CLDN3 inhibits cancer aggressiveness via Wnt-EMT signaling and is a potential prognostic biomarker for hepatocellular carcinoma.
24974365 Anatomical, molecular and pathological consideration of the circumventricular organs.
24478310 2014 Claudin-3 and claudin-5 protein folding and assembly into the tight junction are controlled by non-conserved residues in the transmembrane 3 (TM3) and extracellular loop 2 (ECL2) segments.
More...