Property Summary

NCBI Gene PubMed Count 91
PubMed Score 227.32
PubTator Score 109.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.269 3.4e-02
atypical teratoid / rhabdoid tumor 2.000 2.9e-02
Barrett's esophagus 1.100 4.1e-02
ductal carcinoma in situ 2.100 3.0e-02
esophageal adenocarcinoma 1.500 3.3e-02
intraductal papillary-mucinous adenoma (... -1.100 9.2e-03
invasive ductal carcinoma 4.000 2.6e-03
lung adenocarcinoma 1.800 1.2e-03
nasopharyngeal carcinoma -1.200 1.1e-02
ovarian cancer 3.100 3.5e-08
pituitary cancer -1.300 6.5e-03
psoriasis -1.700 9.0e-23

Gene RIF (73)

AA Sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLL      1 - 70
ALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSAN     71 - 140
TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASL    141 - 210
GTGYDRKDYV                                                                211 - 220
//

Text Mined References (92)

PMID Year Title