Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.17
PubTator Score 18.35

Knowledge Summary

Patent (15,807)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.9e-07
psoriasis 6694 2.2e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.487 3.9e-07
psoriasis 1.100 2.2e-04

Gene RIF (7)

AA Sequence

MCPQLAGAGSMGSPGATTGWGLLDYKTEKYVMTRNWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLE      1 - 70
PQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLANCWV     71 - 140
DEDCPEGEGGTHSHGVKTGQCVVFNGTHRTCEIWSWCPVESGVVPSRPLLAQAQNFTLFIKNTVTFSKFN    141 - 210
FSKSNALETWDPTYFKHCRYEPQFSPYCPVFRIGDLVAKAGGTFEDLALLGGSVGIRVHWDCDLDTGDSG    211 - 280
CWPHYSFQLQEKSYNFRTATHWWEQPGVEARTLLKLYGIRFDILVTGQAGKFGLIPTAVTLGTGAAWLGV    281 - 350
VTFFCDLLLLYVDREAHFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQT    351 - 420
QTPGWPCPSSDTHLPTHSGSL                                                     421 - 441
//

Text Mined References (19)

PMID Year Title