Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.87
PubTator Score 18.35

Knowledge Summary

Patent (15,807)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.000
osteosarcoma 1.487 0.000

Synonym

Accession O15547 F6V3D7 Q32MB6 Q58F04 Q6IC33 Q9UL50 P2X6
Symbols P2X6
P2XM
P2RXL1

Gene

Gene RIF (7)

PMID Text
22378790 one subunit of P2X2 and two subunits of P2X3 form P2X2/3 heteromeric receptors, whereas two subunits of P2X2 and one subunit of P2X6 constitute P2X2/6 receptors
19240061 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18852390 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
15657042 P2X(2) receptors are trimers, whereas the P2X(6) receptor subunits do not form stable oligomers
12088286 Results show that P2X4 and P2X6 receptors are associated with VE-cadherin at HUVEC adherens junctions.

AA Sequence

MCPQLAGAGSMGSPGATTGWGLLDYKTEKYVMTRNWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLE      1 - 70
PQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLANCWV     71 - 140
DEDCPEGEGGTHSHGVKTGQCVVFNGTHRTCEIWSWCPVESGVVPSRPLLAQAQNFTLFIKNTVTFSKFN    141 - 210
FSKSNALETWDPTYFKHCRYEPQFSPYCPVFRIGDLVAKAGGTFEDLALLGGSVGIRVHWDCDLDTGDSG    211 - 280
CWPHYSFQLQEKSYNFRTATHWWEQPGVEARTLLKLYGIRFDILVTGQAGKFGLIPTAVTLGTGAAWLGV    281 - 350
VTFFCDLLLLYVDREAHFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQT    351 - 420
QTPGWPCPSSDTHLPTHSGSL                                                     421 - 441
//

Text Mined References (19)

PMID Year Title
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
22378790 2012 ATP binding site mutagenesis reveals different subunit stoichiometry of functional P2X2/3 and P2X2/6 receptors.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18852390 2008 Ambulatory blood pressure is associated with polymorphic variation in P2X receptor genes.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17895406 2007 Go it alone no more--P2X7 joins the society of heteromeric ATP-gated receptor channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15657042 2005 Atomic force microscopy imaging demonstrates that P2X2 receptors are trimers but that P2X6 receptor subunits do not oligomerize.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...